LXL04_011595 | RubberDandelionOmics

Gene overview

LXL04_011595

Reference: OH-1004 Chr: Chr02 Coordinates: 167866778-167878637 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1656 bp · LXL04_011595|LXL04_011595|OH1004|cDNA

ATGATTAGTTGTGTAGCTCCTCCGCCGAGGTTACCCCAGCCGCCGGAAAGTCCGTTGGCGGTCCCAACGACTCCTGGGGAGAACATGGAGCTCATCCAGAACTGGGTGGAAACAAAGGTGGATAAAGAGAATCCGGTGAAGAAACGGACCATTAAGAAGGCCGCCGGGGAGTTAGCGATGGAGCTAAGGAACACCGCCGGAGCTGTGAGGAGGATGAGCGAAGACGACGCGAGGCGAGGTCCGAACAGGTCACATGCAGT...

CDS

Download CDS FASTA

1656 bp · LXL04_011595|LXL04_011595|OH1004|CDS

ATGATTAGTTGTGTAGCTCCTCCGCCGAGGTTACCCCAGCCGCCGGAAAGTCCGTTGGCGGTCCCAACGACTCCTGGGGAGAACATGGAGCTCATCCAGAACTGGGTGGAAACAAAGGTGGATAAAGAGAATCCGGTGAAGAAACGGACCATTAAGAAGGCCGCCGGGGAGTTAGCGATGGAGCTAAGGAACACCGCCGGAGCTGTGAGGAGGATGAGCGAAGACGACGCGAGGCGAGGTCCGAACAGGTCACATGCAGT...

Protein

Download Protein FASTA

551 aa · LXL04_011595|LXL04_011595|OH1004|PROTEIN

MISCVAPPPRLPQPPESPLAVPTTPGENMELIQNWVETKVDKENPVKKRTIKKAAGELAMELRNTAGAVRRMSEDDARRGPNRSHAVPIATRAKTEPETAAIPALPMSVAVKSRLSRIIGMSGGAAKVETKQAKKEIHERWNARMAVNEPNVRRTVREPFGGKFVMFVYLINERTRTRFPVRLVKRTNTNNALVRLFMFVKVRIYVRSIMFVHICSFTFHVRGIQLFNNKFSGSIPPTFSSCTVLQNLDFGNNSLVGEIP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011595`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011595

Location Chr02:167866778-167878637 (+)

Description Similar to ACX3: Acyl-coenzyme A oxidase 3, peroxisomal

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g06290`	Catalyzes the desaturation of medium-chain acyl-CoAs to 2-trans-enoyl-CoAs.	No verified direct reference in this release
`At3g51740`	Probably inactive leucine-rich repeat receptor-like protein kinase IMK2.	No verified direct reference in this release
`At1g06310`	Catalyzes the desaturation of acyl-CoAs to 2-trans-enoyl-CoAs.	No verified direct reference in this release
`At3g56100`	Can phosphorylate AGL24.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0225300`	May be involved in regulation of plant growth through the brassinosteroid (BR) signaling pathway.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011595 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006635 fatty acid beta-oxidation Biological Process

GO:0033540 fatty acid beta-oxidation using acyl-CoA oxidase Biological Process

GO:0051791 medium-chain fatty acid metabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0003997 acyl-CoA oxidase activity Molecular Function

GO:0004672 protein kinase activity Molecular Function

GO:0005504 fatty acid binding Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G06290

ath:AT3G51740

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.314

Rank 1 · LXL04_011595 · OH-1004

Cytoplasm0.309

Rank 2 · LXL04_011595 · OH-1004

Cell membrane0.275

Rank 3 · LXL04_011595 · OH-1004

Mitochondrion0.106

Rank 4 · LXL04_011595 · OH-1004

Endoplasmic reticulum0.091

Rank 5 · LXL04_011595 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P0CZ23`	Arabidopsis thaliana	Acyl-coenzyme A oxidase 3, peroxisomal	83.333%	Swiss-Prot	weak database homology
`Q9SCT4`	Arabidopsis thaliana	Probably inactive leucine-rich repeat receptor-like protein kinase IMK2	48.515%	Swiss-Prot	weak database homology
`Q9LMI7`	Arabidopsis thaliana	Putative acyl-coenzyme A oxidase 3.2, peroxisomal	75.926%	Swiss-Prot	weak database homology
`C0LGP9`	Arabidopsis thaliana	Probable leucine-rich repeat receptor-like protein kinase IMK3	49.462%	Swiss-Prot	weak database homology
`Q67X31`	Oryza sativa subsp. japonica	LRR receptor kinase SERK2	39.773%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card