LXL04_011521 | RubberDandelionOmics

Gene overview

LXL04_011521

Reference: OH-1004 Chr: Chr02 Coordinates: 166068338-166072747 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2211 bp · LXL04_011521|LXL04_011521|OH1004|cDNA

ATGATGAAGTTGTTAAAGACATGCCTACTGATTTCTTTGGCTATTGTCATATCTGCAATAGATGAAGAGCGAAAGGTGTTTATAGCTTACCTGGGATCTCTCCCGGAAGGAGAATTTTCCGCTTCAGTGCATCATAATGCAATATTGCAAAAAGTTATGAACCCCAGGTTGGCAAGCAAATCACTGATAATGAGTTACAAAAGAAGCTTCAACGGATTTGCTGCTCATCTCTCCCAAGAAGAAAAACAAAAGTTGGCTCG...

CDS

Download CDS FASTA

2211 bp · LXL04_011521|LXL04_011521|OH1004|CDS

ATGATGAAGTTGTTAAAGACATGCCTACTGATTTCTTTGGCTATTGTCATATCTGCAATAGATGAAGAGCGAAAGGTGTTTATAGCTTACCTGGGATCTCTCCCGGAAGGAGAATTTTCCGCTTCAGTGCATCATAATGCAATATTGCAAAAAGTTATGAACCCCAGGTTGGCAAGCAAATCACTGATAATGAGTTACAAAAGAAGCTTCAACGGATTTGCTGCTCATCTCTCCCAAGAAGAAAAACAAAAGTTGGCTCG...

Protein

Download Protein FASTA

736 aa · LXL04_011521|LXL04_011521|OH1004|PROTEIN

MMKLLKTCLLISLAIVISAIDEERKVFIAYLGSLPEGEFSASVHHNAILQKVMNPRLASKSLIMSYKRSFNGFAAHLSQEEKQKLARIDGIISVFPCQEVHLHTTRSWDFMGFPTTIERSPAVESNIIIGVIDSGIWPESESFSDEGIGPIPAKWKGECRGGIDFTCNRKIIGARFYGMEESVTDMIGHGTHVSSILAGNQVPKANYYGLAQGIARGGVPSSRLAVYKVCGGASCVYRDILAAFDDAISDGVDIISISMG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011521`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011521

Location Chr02:166068338-166072747 (+)

Description Similar to SBT4.3: Subtilisin-like protease SBT4.3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g59190`	Subtilisin-like protease SBT4.3.	No verified direct reference in this release
`At5g59100`	Subtilisin-like protease SBT4.4.	No verified direct reference in this release
`At3g46850`	Subtilisin-like protease SBT4.6.	No verified direct reference in this release
`At5g59130`	Subtilisin-like protease SBT4.11.	No verified direct reference in this release
`At5g59120`	Subtilisin-like protease SBT4.13.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011521 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0046686 response to cadmium ion Biological Process

GO:0005576 extracellular region Cellular Component

GO:0004252 serine-type endopeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT3G46850

ath:AT5G59100

ath:AT5G59120

ath:AT5G59130

ath:AT5G59190

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.459

Rank 1 · LXL04_011521 · OH-1004

Lysosome / Vacuole0.160

Rank 2 · LXL04_011521 · OH-1004

Cell membrane0.114

Rank 3 · LXL04_011521 · OH-1004

Cytoplasm0.104

Rank 4 · LXL04_011521 · OH-1004

Endoplasmic reticulum0.093

Rank 5 · LXL04_011521 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05922.22Inhibitor_I927-103 aa

PF00082.28Peptidase_S8125-561 aa

PF17766.8fn3_6605-704 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011521	`PF05922.22`	Inhibitor_I9	27	103	7.6e-11	43.3
LXL04_011521	`PF00082.28`	Peptidase_S8	125	561	8.6e-46	157.2
LXL04_011521	`PF17766.8`	fn3_6	605	704	3.7e-26	91.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FIF8`	Arabidopsis thaliana	Subtilisin-like protease SBT4.3	49.863%	Swiss-Prot	moderate database homology
`Q9FGU3`	Arabidopsis thaliana	Subtilisin-like protease SBT4.4	48.801%	Swiss-Prot	moderate database homology
`Q9STF7`	Arabidopsis thaliana	Subtilisin-like protease SBT4.6	47.678%	Swiss-Prot	moderate database homology
`Q9FIG1`	Arabidopsis thaliana	Subtilisin-like protease SBT4.11	46.970%	Swiss-Prot	moderate database homology
`Q9FIG2`	Arabidopsis thaliana	Subtilisin-like protease SBT4.13	47.199%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card