LXL04_011509 | RubberDandelionOmics

Gene overview

LXL04_011509

Reference: OH-1004 Chr: Chr02 Coordinates: 165819839-165821728 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1890 bp · LXL04_011509|LXL04_011509|OH1004|cDNA

ATGGCAGTGCCAATGGCTTCACCCTCCCCACCCTTCCCACTACAACCCTCACAACCAACCCTAACACAAACACCAATCATGAAACTCTACTCCGTCTTCCTATTCATCCTCACCGCCACCGCCATTGTCGCCGGAGTTTCCGCCGTGGAAGACGATGTACGGTGCCTTCGAGGGTTGAAAGCCGCACTCACAGATACACAGGGGAAGCTCACTACCTGGTCTTTCACAAATGACTCCGTCACTTCCTTATGCAAACTCGT...

CDS

Download CDS FASTA

1890 bp · LXL04_011509|LXL04_011509|OH1004|CDS

ATGGCAGTGCCAATGGCTTCACCCTCCCCACCCTTCCCACTACAACCCTCACAACCAACCCTAACACAAACACCAATCATGAAACTCTACTCCGTCTTCCTATTCATCCTCACCGCCACCGCCATTGTCGCCGGAGTTTCCGCCGTGGAAGACGATGTACGGTGCCTTCGAGGGTTGAAAGCCGCACTCACAGATACACAGGGGAAGCTCACTACCTGGTCTTTCACAAATGACTCCGTCACTTCCTTATGCAAACTCGT...

Protein

Download Protein FASTA

629 aa · LXL04_011509|LXL04_011509|OH1004|PROTEIN

MAVPMASPSPPFPLQPSQPTLTQTPIMKLYSVFLFILTATAIVAGVSAVEDDVRCLRGLKAALTDTQGKLTTWSFTNDSVTSLCKLVGVSCWNEKENRLISIQLPEFSLSGSLPDSLQFCRSLQSLDLSKNSISGSIPPQICTWLPYLVTLDLSGNSLSGNIPPEIQNCKFLNNLLLSDNSFSGTIPYQIGQLERLKKLDVSNNDLSGSIPDDLSKFETESFTGNNGLCGQPLNSKCGSLNNKNLAIIIAAGILGAAASL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011509`
TK1151 ID	TkA03G594510
OH-1004 ID	LXL04_011509
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011509

Location Chr02:165819839-165821728 (+)

Description Similar to At1g27190: Probable inactive receptor kinase At1g27190

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g27190`	Probable inactive receptor kinase At1g27190.	No verified direct reference in this release
`At1g69990`	Probable LRR receptor-like serine/threonine-protein kinase At1g69990.	No verified direct reference in this release
`At3g28450`	Pseudokinases lacking protein kinase activity and unable to bind ATP-analogs.	Structure of the pseudokinase domain of BIR2, a regulator of BAK1-mediated immune signaling in Arabidopsis.2014 · DOI: 10.1016/j.jsb.2014.02.005
`At5g48380`	Probably inactive leucine-rich repeat receptor-like protein kinase At5g48380.	No verified direct reference in this release
`At5g07280`	Receptor with a serine/threonine-protein kinase activity required for the specification of the correct number of male archesporial initials and for the subsequent specification of tapetal and middle cell layer identities.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011509 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009556 microsporogenesis Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0010234 anther wall tapetum cell fate specification Biological Process

GO:0031348 negative regulation of defense response Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045088 regulation of innate immune response Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:1900150 regulation of defense response to fungus Biological Process

GO:1900425 negative regulation of defense response to bacterium Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT1G27190

ath:AT1G69990

ath:AT3G28450

ath:AT5G07280

ath:AT5G48380

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.867

Rank 1 · LXL04_011509 · OH-1004

Endoplasmic reticulum0.083

Rank 2 · LXL04_011509 · OH-1004

Cytoplasm0.068

Rank 3 · LXL04_011509 · OH-1004

Nucleus0.049

Rank 4 · LXL04_011509 · OH-1004

Lysosome / Vacuole0.025

Rank 5 · LXL04_011509 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13855.13LRR_8114-158 aa

PF13855.13LRR_8121-181 aa

PF12799.14LRR_4122-159 aa

PF00069.32Pkinase336-597 aa

PF07714.24PK_Tyr_Ser-Thr346-538 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011509	`PF13855.13`	LRR_8	114	158	3.4e-09	37.1
LXL04_011509	`PF13855.13`	LRR_8	121	181	3.4e-09	37.1
LXL04_011509	`PF12799.14`	LRR_4	122	159	1.3e-08	35.5
LXL04_011509	`PF00069.32`	Pkinase	336	597	1.3e-22	81.2
LXL04_011509	`PF07714.24`	PK_Tyr_Ser-Thr	346	538	8.3e-30	104.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O04567`	Arabidopsis thaliana	Probable inactive receptor kinase At1g27190	62.957%	Swiss-Prot	strong database homology
`C0LGI5`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase At1g69990	59.359%	Swiss-Prot	strong database homology
`Q9LSI9`	Arabidopsis thaliana	Inactive LRR receptor-like serine/threonine-protein kinase BIR2	55.966%	Swiss-Prot	strong database homology
`Q9ASS4`	Arabidopsis thaliana	Probably inactive leucine-rich repeat receptor-like protein kinase At5g48380	45.234%	Swiss-Prot	moderate database homology
`Q9LYN8`	Arabidopsis thaliana	Leucine-rich repeat receptor protein kinase EMS1	34.432%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card