RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_011497
Reference: OH-1004 Chr: Chr02 Coordinates: 165701092-165705308 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2829 bp · LXL04_011497|LXL04_011497|OH1004|cDNA

ATGAAGAGAAATTTATCAAATCTAGTTAGAAAGGGATTTTATACAGAAGCTCTTTCCTTATTTTCAAAGCTCCATTTTCAGTCACACCCCCTCAACGAATTCACATTTCCTTTCCTTCTTAAAGCATGCACGCAGCTCAAACTACTCCTCCATGGCCAGATGCTTCACGCCCATCTCACAAAAACTGGATTCAGTTCAGATATATACACCGCCACATCCCTCACCGACATGTACTTCAAGTTTCAGCTCATCGAAAGTGC...

CDS

Download CDS FASTA

2829 bp · LXL04_011497|LXL04_011497|OH1004|CDS

ATGAAGAGAAATTTATCAAATCTAGTTAGAAAGGGATTTTATACAGAAGCTCTTTCCTTATTTTCAAAGCTCCATTTTCAGTCACACCCCCTCAACGAATTCACATTTCCTTTCCTTCTTAAAGCATGCACGCAGCTCAAACTACTCCTCCATGGCCAGATGCTTCACGCCCATCTCACAAAAACTGGATTCAGTTCAGATATATACACCGCCACATCCCTCACCGACATGTACTTCAAGTTTCAGCTCATCGAAAGTGC...

Protein

Download Protein FASTA

942 aa · LXL04_011497|LXL04_011497|OH1004|PROTEIN

MKRNLSNLVRKGFYTEALSLFSKLHFQSHPLNEFTFPFLLKACTQLKLLLHGQMLHAHLTKTGFSSDIYTATSLTDMYFKFQLIESALKVFDEITEPTTTLINVVLSGFSQNKHHKKCLDVFKQVTEYGPKPDSATIAILLSDWDINLKYGLQIHCWAAKIGVETDIYVATSLLTMYSNFEDPMAALIVFKHIHNRNIACYNAFLTGLLQNQNFQPVLETFKQMLQSSNQIPNPVTFLSVLSACSDLKNLKFGRQVHGLL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_011497
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_011497
LocationChr02:165701092-165705308 (+)
DescriptionSimilar to PCMP-E22: Pentatricopeptide repeat-containing protein At2g02750
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g02750 Pentatricopeptide repeat-containing protein At2g02750. No verified direct reference in this release
At1g11290 Involved in multiple sites RNA editing events in chloroplasts.
Pentatricopeptide repeat proteins with the DYW motif have distinct molecular functions in RNA editing and RNA cleavage in Arabidopsis chloroplasts.2009 · DOI: 10.1105/tpc.108.064667
At3g01580 Putative pentatricopeptide repeat-containing protein At3g01580. No verified direct reference in this release
At4g35130 Pentatricopeptide repeat-containing protein At4g35130, chloroplastic. No verified direct reference in this release
At5g27110 Pentatricopeptide repeat-containing protein At5g27110. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_011497 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0006397 mRNA processing Biological Process
GO:0009451 RNA modification Biological Process
GO:0016556 mRNA modification Biological Process
GO:0005739 mitochondrion Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0003723 RNA binding Molecular Function
GO:0003729 mRNA binding Molecular Function
GO:0004519 endonuclease activity Molecular Function
GO:0008270 zinc ion binding Molecular Function
KEGG gene cross-reference
ath:AT1G11290
ath:AT2G02750
ath:AT3G01580
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.575
Rank 1 · LXL04_011497 · OH-1004
Plastid0.277
Rank 2 · LXL04_011497 · OH-1004
Nucleus0.072
Rank 3 · LXL04_011497 · OH-1004
Cytoplasm0.038
Rank 4 · LXL04_011497 · OH-1004
Cell membrane0.008
Rank 5 · LXL04_011497 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13041.13PPR_297-142 aa
PF13041.13PPR_2197-245 aa
PF13041.13PPR_2301-348 aa
PF29070.1MSC6_N432-528 aa
PF13041.13PPR_2435-482 aa
PF12854.14PPR_1435-462 aa
PF01535.27PPR437-466 aa
PF13812.13PPR_3437-481 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_011497PF13041.13PPR_2971429.8e-63208.8
LXL04_011497PF13041.13PPR_21972459.8e-63208.8
LXL04_011497PF13041.13PPR_23013489.8e-63208.8
LXL04_011497PF29070.1MSC6_N4325281.8e-2280.7
LXL04_011497PF13041.13PPR_24354829.8e-63208.8
LXL04_011497PF12854.14PPR_14354621.3e-2383.1
LXL04_011497PF01535.27PPR4374662.6e-48159.7
LXL04_011497PF13812.13PPR_34374811.8e-2692.7
LXL04_011497PF20431.5E_motif5506112.9e-1453.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q1PFA6Arabidopsis thalianaPentatricopeptide repeat-containing protein At2g0275045.915%Swiss-Protmoderate database homology
Q3E6Q1Arabidopsis thalianaPentatricopeptide repeat-containing protein At1g11290, chloroplastic31.509%Swiss-Protmoderate database homology
Q9SS97Arabidopsis thalianaPutative pentatricopeptide repeat-containing protein At3g0158029.921%Swiss-Protweak database homology
O49619Arabidopsis thalianaPentatricopeptide repeat-containing protein At4g35130, chloroplastic31.280%Swiss-Protmoderate database homology
O04659Arabidopsis thalianaPentatricopeptide repeat-containing protein At5g2711030.794%Swiss-Protmoderate database homology

JBrowse

View in Genome Browser