LXL04_011491 | RubberDandelionOmics

Gene overview

LXL04_011491

Reference: OH-1004 Chr: Chr02 Coordinates: 165553248-165553667 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

420 bp · LXL04_011491|LXL04_011491|OH1004|cDNA

ATGCCATCGACACTCACAGGGGACGATGAAGAAATCGTTTTCGTTTACCTTTCTGGTTCTGCTGACATGGCTCGCCGCTTTCGTAACGAGTCAAGAAGACGATGCTCGGATTCGGATCCAACCGAAGTTTTATCAGACTGGAAGGCGGCGACAGCGGCGTGTTCATGGCGGGGGGTGGTTTGTTCGAAAGAGGACCGTGTCACGGCGGTGAATCTCACCGGTGATTACCTCACCGGTACGCTTGACGTATCTGAACTTAT...

CDS

Download CDS FASTA

420 bp · LXL04_011491|LXL04_011491|OH1004|CDS

ATGCCATCGACACTCACAGGGGACGATGAAGAAATCGTTTTCGTTTACCTTTCTGGTTCTGCTGACATGGCTCGCCGCTTTCGTAACGAGTCAAGAAGACGATGCTCGGATTCGGATCCAACCGAAGTTTTATCAGACTGGAAGGCGGCGACAGCGGCGTGTTCATGGCGGGGGGTGGTTTGTTCGAAAGAGGACCGTGTCACGGCGGTGAATCTCACCGGTGATTACCTCACCGGTACGCTTGACGTATCTGAACTTAT...

Protein

Download Protein FASTA

139 aa · LXL04_011491|LXL04_011491|OH1004|PROTEIN

MPSTLTGDDEEIVFVYLSGSADMARRFRNESRRRCSDSDPTEVLSDWKAATAACSWRGVVCSKEDRVTAVNLTGDYLTGTLDVSELMLITTLTDIYFAGNYFFGNLSFSSNSCSFQRNLRSHFKPQRNLRSHFKPQRNL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011491`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011491

Location Chr02:165553248-165553667 (-)

Description Similar to BRL1: Serine/threonine-protein kinase BRI1-like 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g55610`	Receptor with a serine/threonine-protein kinase activity.	BRL1, a leucine-rich repeat receptor-like protein kinase, is functionally redundant with BRI1 in regulating Arabidopsis brassinosteroid signaling.2004 · DOI: 10.1111/j.1365-313x.2004.02214.x BRL1 and BRL3 are novel brassinosteroid receptors that function in vascular differentiation in Arabidopsis.2004 · DOI: 10.1242/dev.01403
`At3g13380`	Receptor with a dual specificity kinase activity acting on both serine/threonine- and tyrosine-containing substrates.	BRL1 and BRL3 are novel brassinosteroid receptors that function in vascular differentiation in Arabidopsis.2004 · DOI: 10.1242/dev.01403
`At5g65700`	LRR-rich receptor-like kinase (LRR-RLK) that, similarly to CLV1 and BAM3, participates in the detection of the CLAVATA-family peptides (e.g. CLE25, CLE26 and CLE45), and to the regulation of the triggered signaling required for protophloem differentiation and meristems maintenance through the phosphorylation of CIK proteins (CIKs) and of PBL34, PBL35 and PBL36.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011491 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009414 response to water deprivation Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009729 detection of brassinosteroid stimulus Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0009755 hormone-mediated signaling pathway Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0009934 regulation of meristem structural organization Biological Process

GO:0010075 regulation of meristem growth Biological Process

GO:0030154 cell differentiation Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0048229 gametophyte development Biological Process

GO:0048437 floral organ development Biological Process

KEGG gene cross-reference

ath:AT1G55610

ath:AT3G13380

ath:AT5G65700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.335

Rank 1 · LXL04_011491 · OH-1004

Nucleus0.275

Rank 2 · LXL04_011491 · OH-1004

Extracellular0.186

Rank 3 · LXL04_011491 · OH-1004

Cell membrane0.146

Rank 4 · LXL04_011491 · OH-1004

Endoplasmic reticulum0.094

Rank 5 · LXL04_011491 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZWC8`	Arabidopsis thaliana	Serine/threonine-protein kinase BRI1-like 1	36.782%	Swiss-Prot	moderate database homology
`Q9LJF3`	Arabidopsis thaliana	Receptor-like protein kinase BRI1-like 3	40.299%	Swiss-Prot	weak database homology
`O49545`	Arabidopsis thaliana	Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM1	39.286%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card