LXL04_011390 | RubberDandelionOmics

Gene overview

LXL04_011390

Reference: OH-1004 Chr: Chr02 Coordinates: 163663071-163663736 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

666 bp · LXL04_011390|LXL04_011390|OH1004|cDNA

ATGGGTTTGAAGAATctcttcaagaagaagaagaaaaccgGTGACGATAATAGCACCCACTCACACCAACATGACGACGATAACGAAAATGAAGACGAAGACGAAGAACCCACAGTCCCGCCGACGACTTCCAACAAACTGACGTCGGAGGCACAGCGCGTTAACTCCTTCAACGCTCGCGCTCGGATCGAGGAGGAGTTGGAGCAGATTTTCAAGAAATTCGACGTGAATGGGGACGGTAAGATCTGCTCATCGGAGCT...

CDS

Download CDS FASTA

666 bp · LXL04_011390|LXL04_011390|OH1004|CDS

ATGGGTTTGAAGAATCTCTTCAAGAAGAAGAAGAAAACCGGTGACGATAATAGCACCCACTCACACCAACATGACGACGATAACGAAAATGAAGACGAAGACGAAGAACCCACAGTCCCGCCGACGACTTCCAACAAACTGACGTCGGAGGCACAGCGCGTTAACTCCTTCAACGCTCGCGCTCGGATCGAGGAGGAGTTGGAGCAGATTTTCAAGAAATTCGACGTGAATGGGGACGGTAAGATCTGCTCATCGGAGCT...

Protein

Download Protein FASTA

221 aa · LXL04_011390|LXL04_011390|OH1004|PROTEIN

MGLKNLFKKKKKTGDDNSTHSHQHDDDNENEDEDEEPTVPPTTSNKLTSEAQRVNSFNARARIEEELEQIFKKFDVNGDGKICSSELGSIMASLGHEPTEEKLKNMIKEVDRDGDGFINLQEFIELNTKDVDPTEVLENLKDAFSVFDIDKNGLITAEELQNVLASLGDECTIADSQKMIAGADQDGDGMINFDEFKVMMKNGTHFDSMGLQQKQASQKKD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011390`
TK1151 ID	TkA03G586000
OH-1004 ID	LXL04_011390
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	90.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011390

Location Chr02:163663071-163663736 (-)

Description Similar to CML25: Probable calcium-binding protein CML25

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g24620`	Potential calcium sensor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0949500`	Potential calcium sensor.	No verified direct reference in this release
`Os05g0380900`	Potential calcium sensor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011390 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0048767 root hair elongation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005509 calcium ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G24620

dosa:Os01g0949500

dosa:Os05g0380900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.443

Rank 1 · LXL04_011390 · OH-1004

Cytoplasm0.353

Rank 2 · LXL04_011390 · OH-1004

Nucleus0.197

Rank 3 · LXL04_011390 · OH-1004

Endoplasmic reticulum0.082

Rank 4 · LXL04_011390 · OH-1004

Lysosome / Vacuole0.080

Rank 5 · LXL04_011390 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10591.16SPARC_Ca_bdg38-124 aa

PF21008.4AIF-163-126 aa

PF13499.13EF-hand_764-126 aa

PF00036.39EF-hand_166-94 aa

PF13405.13EF-hand_666-95 aa

PF13202.13EF-hand_567-91 aa

PF30551.1CFAP251_C79-181 aa

PF13833.13EF-hand_887-126 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011390	`PF10591.16`	SPARC_Ca_bdg	38	124	3.9e-08	34.3
LXL04_011390	`PF21008.4`	AIF-1	63	126	2.8e-10	41.3
LXL04_011390	`PF13499.13`	EF-hand_7	64	126	1.7e-28	99.5
LXL04_011390	`PF00036.39`	EF-hand_1	66	94	3.9e-33	111.2
LXL04_011390	`PF13405.13`	EF-hand_6	66	95	5.2e-27	91.7
LXL04_011390	`PF13202.13`	EF-hand_5	67	91	5.1e-24	83.3
LXL04_011390	`PF30551.1`	CFAP251_C	79	181	3.6e-08	34.0
LXL04_011390	`PF13833.13`	EF-hand_8	87	126	1.6e-19	70.1
LXL04_011390	`PF00036.39`	EF-hand_1	102	126	3.9e-33	111.2
LXL04_011390	`PF13499.13`	EF-hand_7	138	200	1.7e-28	99.5
LXL04_011390	`PF00036.39`	EF-hand_1	140	167	3.9e-33	111.2
LXL04_011390	`PF13405.13`	EF-hand_6	140	168	5.2e-27	91.7
LXL04_011390	`PF13202.13`	EF-hand_5	140	164	5.1e-24	83.3
LXL04_011390	`PF14658.13`	EF-hand_9	143	201	1.3e-11	45.5
LXL04_011390	`PF13833.13`	EF-hand_8	152	202	1.6e-19	70.1
LXL04_011390	`PF00036.39`	EF-hand_1	177	202	3.9e-33	111.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FYK2`	Arabidopsis thaliana	Probable calcium-binding protein CML25	65.972%	Swiss-Prot	moderate database homology
`Q8RZB5`	Oryza sativa subsp. japonica	Probable calcium-binding protein CML10	53.472%	Swiss-Prot	moderate database homology
`Q6L4D4`	Oryza sativa subsp. japonica	Probable calcium-binding protein CML15	45.139%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card