LXL04_011387 | RubberDandelionOmics

Gene overview

LXL04_011387

Reference: OH-1004 Chr: Chr02 Coordinates: 163643180-163647136 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1713 bp · LXL04_011387|LXL04_011387|OH1004|cDNA

ATGGCATCAATTACTAGTGAACACGGATATGATCGTCTAAAACAAGTGAAACAATTCGATGAATCAAAAATTGGTGTAAAGGGATTAGTAGACTCTGGAATCACCACCATCCCCACCTTCTTCCACCAACCACCGGAGAATCTCCCTGGTCCAAAACCTAAAAACCAACCAAATGTAACCGTGCCTGTCATTGATTTATCCAAGGAAAGATCAATTGTTGTTGAAGAAATTCAACGATCAGCTTCCACATTAGGGTTTTT...

CDS

Download CDS FASTA

1713 bp · LXL04_011387|LXL04_011387|OH1004|CDS

ATGGCATCAATTACTAGTGAACACGGATATGATCGTCTAAAACAAGTGAAACAATTCGATGAATCAAAAATTGGTGTAAAGGGATTAGTAGACTCTGGAATCACCACCATCCCCACCTTCTTCCACCAACCACCGGAGAATCTCCCTGGTCCAAAACCTAAAAACCAACCAAATGTAACCGTGCCTGTCATTGATTTATCCAAGGAAAGATCAATTGTTGTTGAAGAAATTCAACGATCAGCTTCCACATTAGGGTTTTT...

Protein

Download Protein FASTA

570 aa · LXL04_011387|LXL04_011387|OH1004|PROTEIN

MASITSEHGYDRLKQVKQFDESKIGVKGLVDSGITTIPTFFHQPPENLPGPKPKNQPNVTVPVIDLSKERSIVVEEIQRSASTLGFFQIVNHSIPITLIDAVLNGLKSFFEQPTEYKMQFYHRDIEKGAAYSTNFDLYQSNAASWRDTLQVRMAPMEPAWEIVPEMCTAELADWDKAVAELGEELMSILCEGLGVKSDRKMRTRAKELLTSSLQLLVVEMVLPISRFPSISIPAIICLLEMENSRNYLDIEATSSFNASL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011387`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011387

Location Chr02:163643180-163647136 (+)

Description Similar to ASY1: Meiosis-specific protein ASY1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: F4HRV8`	Required for normal meiosis in male and female gametophytes.	No verified direct reference in this release
`At1g06620`	1-aminocyclopropane-1-carboxylate oxidase homolog 1.	No verified direct reference in this release
`At2g25450`	Necessary for the hydroxylation of but-3-enyl glucosinolate to 2-hydroxybut-3-enyl glucosinolate, which is toxic to insects, bacteria and nematodes, inhibits seed germination and produces bitter flavors.	A novel 2-oxoacid-dependent dioxygenase involved in the formation of the goiterogenic 2-hydroxybut-3-enyl glucosinolate and generalist insect resistance in Arabidopsis,.2008 · DOI: 10.1104/pp.108.129981
`At1g06650`	1-aminocyclopropane-1-carboxylate oxidase homolog 3.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0506800`	Essential factor for meiotic homologous chromosome pairing (synapsis).	An insertional mutation in the rice PAIR2 gene, the ortholog of Arabidopsis ASY1, results in a defect in homologous chromosome pairing during meiosis.2004 · DOI: 10.1007/s00438-003-0934-z PAIR2 is essential for homologous chromosome synapsis in rice meiosis I.2006 · DOI: 10.1242/jcs.02736

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011387 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007129 homologous chromosome pairing at meiosis Biological Process

GO:0007130 synaptonemal complex assembly Biological Process

GO:0009554 megasporogenesis Biological Process

GO:0009556 microsporogenesis Biological Process

GO:0009620 response to fungus Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0010439 regulation of glucosinolate biosynthetic process Biological Process

GO:0019761 glucosinolate biosynthetic process Biological Process

GO:0051026 chiasma assembly Biological Process

GO:0051598 meiotic recombination checkpoint signaling Biological Process

GO:0000228 nuclear chromosome Cellular Component

GO:0000775 chromosome, centromeric region Cellular Component

KEGG gene cross-reference

ath:AT1G06620

ath:AT1G06650

ath:AT1G67370

ath:AT2G25450

dosa:Os09g0506800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.739

Rank 1 · LXL04_011387 · OH-1004

Cytoplasm0.304

Rank 2 · LXL04_011387 · OH-1004

Cell membrane0.037

Rank 3 · LXL04_011387 · OH-1004

Mitochondrion0.036

Rank 4 · LXL04_011387 · OH-1004

Endoplasmic reticulum0.025

Rank 5 · LXL04_011387 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14226.13DIOX_N61-155 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011387	`PF14226.13`	DIOX_N	61	155	3.3e-17	63.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HRV8`	Arabidopsis thaliana	Meiosis-specific protein ASY1	47.112%	Swiss-Prot	moderate database homology
`Q84MB3`	Arabidopsis thaliana	1-aminocyclopropane-1-carboxylate oxidase homolog 1	42.564%	Swiss-Prot	weak database homology
`Q9SKK4`	Arabidopsis thaliana	Probable 2-oxoacid dependent dioxygenase	41.327%	Swiss-Prot	weak database homology
`Q8H1S4`	Arabidopsis thaliana	1-aminocyclopropane-1-carboxylate oxidase homolog 3	39.000%	Swiss-Prot	weak database homology
`Q76CY8`	Oryza sativa subsp. japonica	Meiosis-specific protein PAIR2	39.528%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card