LXL04_011379 | RubberDandelionOmics

Gene overview

LXL04_011379

Reference: OH-1004 Chr: Chr02 Coordinates: 163527287-163528277 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

921 bp · LXL04_011379|LXL04_011379|OH1004|cDNA

ATGGATATGGAGATTTCACATGAAACAAACCACAAACAAGATCAAACAAATCAAGATTCATCAAGTGTAGAACAACCCCATGAATCTTTATACCTTGTATTACCTTATCTTCCAGTTTTTGAGCTTCTTGCCATGGCTCAAGTATGCAAATCCTTCAACGATGCTTTAAATGATGATATATTGCCATGGCTCAACATCATAGTGGACGAAAAGCTTCGAAGATCACGACTTTCAAATGAAATTCTTGTCAAGATTGCTTC...

CDS

Download CDS FASTA

921 bp · LXL04_011379|LXL04_011379|OH1004|CDS

ATGGATATGGAGATTTCACATGAAACAAACCACAAACAAGATCAAACAAATCAAGATTCATCAAGTGTAGAACAACCCCATGAATCTTTATACCTTGTATTACCTTATCTTCCAGTTTTTGAGCTTCTTGCCATGGCTCAAGTATGCAAATCCTTCAACGATGCTTTAAATGATGATATATTGCCATGGCTCAACATCATAGTGGACGAAAAGCTTCGAAGATCACGACTTTCAAATGAAATTCTTGTCAAGATTGCTTC...

Protein

Download Protein FASTA

306 aa · LXL04_011379|LXL04_011379|OH1004|PROTEIN

MDMEISHETNHKQDQTNQDSSSVEQPHESLYLVLPYLPVFELLAMAQVCKSFNDALNDDILPWLNIIVDEKLRRSRLSNEILVKIASRAMGRLRTLVLINCNRITDDGLQTVITMNPNIEKLHVPQCTSLTSEGMIQAVTMLNQHGTTLKSLKINGIYNITKDHLQTLRNLLKSQQTQHKQFYPDTSRQYQTDNCPSIDVGICPKCDEVRMVFDYPLETCERKRTIGSCRGCKFCILRCEECGKCVDEDENEAACEDSLC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011379`
TK1151 ID	TkA03G585550
OH-1004 ID	LXL04_011379
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011379

Location Chr02:163527287-163528277 (+)

Description Similar to SKIP28: F-box protein SKIP28

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g01620`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity).	No verified direct reference in this release
`At3g27290`	F-box protein At3g27290.	No verified direct reference in this release
`At3g26000`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011379 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000086 G2/M transition of mitotic cell cycle Biological Process

GO:0000209 protein polyubiquitination Biological Process

GO:0000278 mitotic cell cycle Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0051301 cell division Biological Process

GO:0000151 ubiquitin ligase complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT2G01620

ath:AT3G26000

ath:AT3G27290

hsa:23194

mmu:448987

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.467

Rank 1 · LXL04_011379 · OH-1004

Nucleus0.371

Rank 2 · LXL04_011379 · OH-1004

Mitochondrion0.179

Rank 3 · LXL04_011379 · OH-1004

Cell membrane0.072

Rank 4 · LXL04_011379 · OH-1004

Golgi apparatus0.045

Rank 5 · LXL04_011379 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12937.13F-box-like26-61 aa

PF28114.1At3g27290_F_box_C199-271 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011379	`PF12937.13`	F-box-like	26	61	3.5e-07	30.6
LXL04_011379	`PF28114.1`	At3g27290_F_box_C	199	271	1.2e-24	87.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZU90`	Arabidopsis thaliana	F-box protein SKIP28	41.053%	Swiss-Prot	moderate database homology
`Q9LK24`	Arabidopsis thaliana	F-box protein At3g27290	33.735%	Swiss-Prot	moderate database homology
`Q9LU91`	Arabidopsis thaliana	F-box protein SKIP14	33.068%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card