LXL04_011367 | RubberDandelionOmics

Gene overview

LXL04_011367

Reference: OH-1004 Chr: Chr02 Coordinates: 163304322-163306061 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1740 bp · LXL04_011367|LXL04_011367|OH1004|cDNA

ATGAACCCGCAAAAACCTATAATAGCCTACCCTAACTCTACCTCTTCCTCTACACCCGGCGGCGCTTCTTCGGCTACAACCACTGGACCTTCGCTTCACAGCTTTACTACCTCTGATGTGACCGGAAAAGGGAAGAATATGTGGGACGAGCTTCAAGACCAAGATGCCGGCGTTGATGAGCTGCTGGCGGTCCTGGGCTACAAAGTTAAGTCGTCTGATATGGTTGATGTTGCTCAGAAGATTGAGCATCTCGAAGGAGT...

CDS

Download CDS FASTA

1740 bp · LXL04_011367|LXL04_011367|OH1004|CDS

ATGAACCCGCAAAAACCTATAATAGCCTACCCTAACTCTACCTCTTCCTCTACACCCGGCGGCGCTTCTTCGGCTACAACCACTGGACCTTCGCTTCACAGCTTTACTACCTCTGATGTGACCGGAAAAGGGAAGAATATGTGGGACGAGCTTCAAGACCAAGATGCCGGCGTTGATGAGCTGCTGGCGGTCCTGGGCTACAAAGTTAAGTCGTCTGATATGGTTGATGTTGCTCAGAAGATTGAGCATCTCGAAGGAGT...

Protein

Download Protein FASTA

579 aa · LXL04_011367|LXL04_011367|OH1004|PROTEIN

MNPQKPIIAYPNSTSSSTPGGASSATTTGPSLHSFTTSDVTGKGKNMWDELQDQDAGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLGNDDGLSQIASDSVHYNPSDLSSWLESMICELNPTTEPPMIDDSFMNASAAVVPPDSTSVFVDDLQAIPGNAIYPPAKKAKYSPSSSTSGTTSASTSYNSNPNSVVLVDSQENGIRLVHTLMACAEAIQQENLSLAENLVKQAGMLAVSQAGAMRKVATYFAEALARRIYRL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011367`
TK1151 ID	TkA03G584840
OH-1004 ID	LXL04_011367
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	90.500
Protein coverage (%)	TK1151 100.000 / OH-1004 87.392 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011367

Location Chr02:163304322-163306061 (-)

Description Similar to GAI1: DELLA protein GAI1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g01570`	Probable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011367 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009409 response to cold Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009938 negative regulation of gibberellic acid mediated signaling pathway Biological Process

GO:0010029 regulation of seed germination Biological Process

GO:0010187 negative regulation of seed germination Biological Process

GO:0010218 response to far red light Biological Process

GO:0010628 positive regulation of gene expression Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

KEGG gene cross-reference

ath:AT2G01570

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.919

Rank 1 · LXL04_011367 · OH-1004

Cytoplasm0.137

Rank 2 · LXL04_011367 · OH-1004

Cell membrane0.038

Rank 3 · LXL04_011367 · OH-1004

Plastid0.029

Rank 4 · LXL04_011367 · OH-1004

Endoplasmic reticulum0.028

Rank 5 · LXL04_011367 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12041.14DELLA59-124 aa

PF03514.21GRAS205-577 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011367	`PF12041.14`	DELLA	59	124	4.2e-31	107.4
LXL04_011367	`PF03514.21`	GRAS	205	577	9.1e-136	453.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SLH3`	Arabidopsis thaliana	DELLA protein RGA	66.129%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card