LXL04_011337 | RubberDandelionOmics

Gene overview

LXL04_011337

Reference: OH-1004 Chr: Chr02 Coordinates: 162756332-162758012 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

528 bp · LXL04_011337|LXL04_011337|OH1004|cDNA

ATGGACGATCTGCCTGCCGGTTACCGGCCGAACGTCGGCGTTTGTCTAATCAATTCCAATAATCTGGTGTTCGTGGCTTCCAGGTTAAATGTACCAGGAGCATGGCAAATGCCTCAGGGGGGAATTGAAGAGGGAGAAGAGCCAATTTCTGCAGCAGTGAGGGAACTTCGAGAAGAAACTGGAGTGATTTCTACTGAAATAATTGCCGAGGTTCCAAAATGGTTGACTTACGACTTCCCACCTGCTGTTAAAGCTAAAGT...

CDS

Download CDS FASTA

528 bp · LXL04_011337|LXL04_011337|OH1004|CDS

ATGGACGATCTGCCTGCCGGTTACCGGCCGAACGTCGGCGTTTGTCTAATCAATTCCAATAATCTGGTGTTCGTGGCTTCCAGGTTAAATGTACCAGGAGCATGGCAAATGCCTCAGGGGGGAATTGAAGAGGGAGAAGAGCCAATTTCTGCAGCAGTGAGGGAACTTCGAGAAGAAACTGGAGTGATTTCTACTGAAATAATTGCCGAGGTTCCAAAATGGTTGACTTACGACTTCCCACCTGCTGTTAAAGCTAAAGT...

Protein

Download Protein FASTA

175 aa · LXL04_011337|LXL04_011337|OH1004|PROTEIN

MDDLPAGYRPNVGVCLINSNNLVFVASRLNVPGAWQMPQGGIEEGEEPISAAVRELREETGVISTEIIAEVPKWLTYDFPPAVKAKVNRLWGGGEWHGQAQKWFLMRLTKDESEINLASGEVDPEFSEWKWANPEEVIQQAVDYKRPTYEEVMRTFKTHLNDGGKGAAKCLSTKW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011337`
TK1151 ID	TkA03G582700
OH-1004 ID	LXL04_011337
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011337

Location Chr02:162756332-162758012 (-)

Description Similar to NUDT25: Nudix hydrolase 25

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g30110`	May hydrolyze diadenosine tetraphosphate (Ap₄A), a signal involved in DNA replication and repair.	A diadenosine 5',5''-P1P4 tetraphosphate (Ap4A) hydrolase from Arabidopsis thaliana that is activated preferentially by Mn2+ ions.2008 · DOI: 10.18388/abp.2008_3173
`At3g10620`	Mediates the hydrolysis of some nucleoside diphosphate derivatives.	Molecular characterization of organelle-type Nudix hydrolases in Arabidopsis.2008 · DOI: 10.1104/pp.108.128413
`At5g06340`	Mediates the hydrolysis of some nucleoside diphosphate derivatives.	Molecular characterization of organelle-type Nudix hydrolases in Arabidopsis.2008 · DOI: 10.1104/pp.108.128413

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011337 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006753 nucleoside phosphate metabolic process Biological Process

GO:0015967 diadenosine tetraphosphate catabolic process Biological Process

GO:0019693 ribose phosphate metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004081 bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) activity Molecular Function

GO:0008893 guanosine-3',5'-bis(diphosphate) 3'-diphosphatase activity Molecular Function

GO:0034432 bis(5'-adenosyl)-pentaphosphatase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G30110

ath:AT3G10620

ath:AT5G06340

rsk:RSKD131_2305

rsp:RSP_0931

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.361

Rank 1 · LXL04_011337 · OH-1004

Peroxisome0.220

Rank 2 · LXL04_011337 · OH-1004

Mitochondrion0.202

Rank 3 · LXL04_011337 · OH-1004

Nucleus0.169

Rank 4 · LXL04_011337 · OH-1004

Endoplasmic reticulum0.115

Rank 5 · LXL04_011337 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00293.35NUDIX8-150 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011337	`PF00293.35`	NUDIX	8	150	5.4e-22	79.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C6Z2`	Arabidopsis thaliana	Nudix hydrolase 25	77.401%	Swiss-Prot	strong database homology
`Q9CAF2`	Arabidopsis thaliana	Nudix hydrolase 26, chloroplastic	56.790%	Swiss-Prot	strong database homology
`Q9FNH4`	Arabidopsis thaliana	Nudix hydrolase 27, chloroplastic	53.659%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card