LXL04_011313 | RubberDandelionOmics

Gene overview

LXL04_011313

Reference: OH-1004 Chr: Chr02 Coordinates: 162392724-162395199 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1419 bp · LXL04_011313|LXL04_011313|OH1004|cDNA

ATGGAGAGAGGATTTCTGTTGAGTGAAAGAGATGATAACAGAGTTAATCGTCGATTAACATGGAGCGTATTTGGGGAAGAGGCTATGAAATTCGGATACATAGCAGGGCCGATGGTGGCGGTGACTCTGTCACAGTATTTGTTGCAGGTTATCTCCGTCATGATGGTCGGTCACCTCGGCGAGCTTGCTCTTTCTAGCGCCGCCATTGCTATCTCCATTTCTAGCGTCACCGGCTTCAGCTTAATCATGGGGATGGCAAG...

CDS

Download CDS FASTA

1419 bp · LXL04_011313|LXL04_011313|OH1004|CDS

ATGGAGAGAGGATTTCTGTTGAGTGAAAGAGATGATAACAGAGTTAATCGTCGATTAACATGGAGCGTATTTGGGGAAGAGGCTATGAAATTCGGATACATAGCAGGGCCGATGGTGGCGGTGACTCTGTCACAGTATTTGTTGCAGGTTATCTCCGTCATGATGGTCGGTCACCTCGGCGAGCTTGCTCTTTCTAGCGCCGCCATTGCTATCTCCATTTCTAGCGTCACCGGCTTCAGCTTAATCATGGGGATGGCAAG...

Protein

Download Protein FASTA

472 aa · LXL04_011313|LXL04_011313|OH1004|PROTEIN

MERGFLLSERDDNRVNRRLTWSVFGEEAMKFGYIAGPMVAVTLSQYLLQVISVMMVGHLGELALSSAAIAISISSVTGFSLIMGMASALETLCGQAYGAQQYKKFGTQTYTAVFSLLLVCIPLSIIWKNTGPLLILIGQNPSISHEAGKFITWLIPAIFAYAALQPLVRFFQMQSMLWPMLLSSIAALLLHIPLCWVLVYKTTLANIGAAISMGVTMWLNVIFLFLYMRYSPSCEKTRAPISMEVVHGMKQFFSYAIPSA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011313`
TK1151 ID	TkA03G581870
OH-1004 ID	LXL04_011313
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011313

Location Chr02:162392724-162395199 (-)

Description Similar to DTX14: Protein DETOXIFICATION 14

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g71140`	Protein DETOXIFICATION 14.	No verified direct reference in this release
`At1g15170`	Protein DETOXIFICATION 12.	No verified direct reference in this release
`At1g15150`	Protein DETOXIFICATION 10.	No verified direct reference in this release
`At1g15160`	Protein DETOXIFICATION 11.	No verified direct reference in this release
`At1g15180`	Protein DETOXIFICATION 13.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011313 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0042908 xenobiotic transport Biological Process

GO:1990961 xenobiotic detoxification by transmembrane export across the plasma membrane Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0015297 antiporter activity Molecular Function

GO:0022857 transmembrane transporter activity Molecular Function

GO:0042910 xenobiotic transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G15150

ath:AT1G15160

ath:AT1G15170

ath:AT1G15180

ath:AT1G71140

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.455

Rank 1 · LXL04_011313 · OH-1004

Lysosome / Vacuole0.275

Rank 2 · LXL04_011313 · OH-1004

Endoplasmic reticulum0.107

Rank 3 · LXL04_011313 · OH-1004

Cytoplasm0.078

Rank 4 · LXL04_011313 · OH-1004

Golgi apparatus0.064

Rank 5 · LXL04_011313 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01554.24MatE37-197 aa

PF01554.24MatE258-419 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011313	`PF01554.24`	MatE	37	197	9.2e-60	201.7
LXL04_011313	`PF01554.24`	MatE	258	419	9.2e-60	201.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C994`	Arabidopsis thaliana	Protein DETOXIFICATION 14	58.511%	Swiss-Prot	strong database homology
`Q8L731`	Arabidopsis thaliana	Protein DETOXIFICATION 12	56.531%	Swiss-Prot	strong database homology
`Q8VYL8`	Arabidopsis thaliana	Protein DETOXIFICATION 10	53.305%	Swiss-Prot	strong database homology
`F4HZH9`	Arabidopsis thaliana	Protein DETOXIFICATION 11	53.913%	Swiss-Prot	strong database homology
`Q94AL1`	Arabidopsis thaliana	Protein DETOXIFICATION 13	56.957%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card