LXL04_011307 | RubberDandelionOmics

Gene overview

LXL04_011307

Reference: OH-1004 Chr: Chr02 Coordinates: 162299851-162300660 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

207 bp · LXL04_011307|LXL04_011307|OH1004|cDNA

ATGGGGCGGAGGAAGCTGGAGATGAAACGAATCGAAGACAAGAATAGCAGACAAGTGACGTTTTCAAAGCGGAGATCAGGATTGATTAAGAAAGCACGGCACCTTTCCCTTCTCTGTGATGTCGACGTCGCCCTCGTCGTCTTCTCCTCCCATGGCAAGCTCTATGAATACTGCAGCGGAGATGCCGACAGGGGTGTAGGAATATAG

CDS

Download CDS FASTA

207 bp · LXL04_011307|LXL04_011307|OH1004|CDS

ATGGGGCGGAGGAAGCTGGAGATGAAACGAATCGAAGACAAGAATAGCAGACAAGTGACGTTTTCAAAGCGGAGATCAGGATTGATTAAGAAAGCACGGCACCTTTCCCTTCTCTGTGATGTCGACGTCGCCCTCGTCGTCTTCTCCTCCCATGGCAAGCTCTATGAATACTGCAGCGGAGATGCCGACAGGGGTGTAGGAATATAG

Protein

Download Protein FASTA

68 aa · LXL04_011307|LXL04_011307|OH1004|PROTEIN

MGRRKLEMKRIEDKNSRQVTFSKRRSGLIKKARHLSLLCDVDVALVVFSSHGKLYEYCSGDADRGVGI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011307`
TK1151 ID	TkA03G581600
OH-1004 ID	LXL04_011307
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	98.500
Protein coverage (%)	TK1151 64.078 / OH-1004 97.059 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011307

Location Chr02:162299851-162300660 (-)

Description Similar to FLC: MADS-box protein FLOWERING LOCUS C

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g10140`	Putative transcription factor that seems to play a central role in the regulation of flowering time in the late-flowering phenotype by interacting with 'FRIGIDA', the autonomous and the vernalization flowering pathways.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0883100`	Probable transcription factor involved in the development of floral organs.	No verified direct reference in this release
`Os09g0507200`	Probable transcription factor.	Characterization of two rice MADS box genes that control flowering time.1997 · PMID: 9339904

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011307 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009266 response to temperature stimulus Biological Process

GO:0009908 flower development Biological Process

GO:0009910 negative regulation of flower development Biological Process

GO:0010048 vernalization response Biological Process

GO:0010097 specification of stamen identity Biological Process

GO:0030154 cell differentiation Biological Process

GO:0042752 regulation of circadian rhythm Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:2000028 regulation of photoperiodism, flowering Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT5G10140

dosa:Os01g0883100

dosa:Os09g0507200

vvi:100232869

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.930

Rank 1 · LXL04_011307 · OH-1004

Cytoplasm0.145

Rank 2 · LXL04_011307 · OH-1004

Cell membrane0.016

Rank 3 · LXL04_011307 · OH-1004

Endoplasmic reticulum0.015

Rank 4 · LXL04_011307 · OH-1004

Extracellular0.011

Rank 5 · LXL04_011307 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00319.24SRF-TF10-57 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011307	`PF00319.24`	SRF-TF	10	57	6.6e-26	90.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S7Q7`	Arabidopsis thaliana	MADS-box protein FLOWERING LOCUS C	72.131%	Swiss-Prot	strong database homology
`Q40702`	Oryza sativa subsp. japonica	MADS-box transcription factor 2	67.797%	Swiss-Prot	strong database homology
`Q9SAR1`	Oryza sativa subsp. japonica	MADS-box transcription factor 8	64.516%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card