Gene Card
Gene overview
cDNA / CDS / Protein Sequences
432 bp · LXL04_011258|LXL04_011258|OH1004|cDNA
ATGGAGGAACAAACGATCGTATATGGCTACAATAACAACCCGAACGAGCCAGAAGAAACCGAAACCATTCTATTAAAAAATCAATCAAAATCCACAACGAAACGCTACAAAGGGGTTTGGAGGAAGAATGGAAGGTGGGCAGCCCGGATCCGAAACCCTATTACTAATTTGCGTGTCAATCTAGGCAAATTTCATTCCTCTAATGCTGCTGTCACTGCTTATTTCACCAAGAAGCGCGAATTCGAGTCGCAGATTAGGGA...
432 bp · LXL04_011258|LXL04_011258|OH1004|CDS
ATGGAGGAACAAACGATCGTATATGGCTACAATAACAACCCGAACGAGCCAGAAGAAACCGAAACCATTCTATTAAAAAATCAATCAAAATCCACAACGAAACGCTACAAAGGGGTTTGGAGGAAGAATGGAAGGTGGGCAGCCCGGATCCGAAACCCTATTACTAATTTGCGTGTCAATCTAGGCAAATTTCATTCCTCTAATGCTGCTGTCACTGCTTATTTCACCAAGAAGCGCGAATTCGAGTCGCAGATTAGGGA...
Protein
Download Protein FASTA143 aa · LXL04_011258|LXL04_011258|OH1004|PROTEIN
MEEQTIVYGYNNNPNEPEETETILLKNQSKSTTKRYKGVWRKNGRWAARIRNPITNLRVNLGKFHSSNAAVTAYFTKKREFESQIRDAKVTNSVMIDTHGLPNTFLQSYLSVFVVMPKRSTNNLDKIFTDPRIWHSKRAFTAM
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_011258 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_011258 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:161195583-161197494 (+) | |||||||||
| Description | Protein of unknown function | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0001666 response to hypoxia Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0009723 response to ethylene Biological Process GO:0009873 ethylene-activated signaling pathway Biological Process GO:0034059 response to anoxia Biological Process GO:0045893 positive regulation of DNA-templated transcription Biological Process GO:0071369 cellular response to ethylene stimulus Biological Process GO:0071454 cellular response to anoxia Biological Process GO:0071456 cellular response to hypoxia Biological Process GO:0005634 nucleus Cellular Component GO:0000976 transcription cis-regulatory region binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G72360 ath:AT3G25890 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.