LXL04_011156 | RubberDandelionOmics

Gene overview

LXL04_011156

Reference: OH-1004 Chr: Chr02 Coordinates: 159096020-159096760 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

741 bp · LXL04_011156|LXL04_011156|OH1004|cDNA

ATGGAAATCATGGCCGAAGGTCTAGAAAGAAGACGCAAACGTGTTCGATCTTCCACTGATATGCCTGTGGGGTACAAGTACAACGACAACGAGGAGAATGATGACGATGAAATTAACCCAAAGAAGTTCATGCAACTGATTAAGAAAAATACGAAGCAGTTTCGTCGAGTTAAGAAAAGTAAAAAGCCGAAGAAACGTCAAACAACAGAGAAGAAAAAGAGTAAACAGGTGCCGATTGTGAGCAATGAAGTAACCCAACG...

CDS

Download CDS FASTA

741 bp · LXL04_011156|LXL04_011156|OH1004|CDS

ATGGAAATCATGGCCGAAGGTCTAGAAAGAAGACGCAAACGTGTTCGATCTTCCACTGATATGCCTGTGGGGTACAAGTACAACGACAACGAGGAGAATGATGACGATGAAATTAACCCAAAGAAGTTCATGCAACTGATTAAGAAAAATACGAAGCAGTTTCGTCGAGTTAAGAAAAGTAAAAAGCCGAAGAAACGTCAAACAACAGAGAAGAAAAAGAGTAAACAGGTGCCGATTGTGAGCAATGAAGTAACCCAACG...

Protein

Download Protein FASTA

246 aa · LXL04_011156|LXL04_011156|OH1004|PROTEIN

MEIMAEGLERRRKRVRSSTDMPVGYKYNDNEENDDDEINPKKFMQLIKKNTKQFRRVKKSKKPKKRQTTEKKKSKQVPIVSNEVTQRLKEYIVNEKNGTEVKVLIQKTLFKSDLKKSQNRLNMPIKQLETLDFLKEHEKQLIHEKEKGLKVKLLGPRLREHKEYSMVLKIWHLKSTENYVLITNWNDFVKENQKDLKKDTMIQVWSFRIKDKLHFAIACLEMDISDAPAPISDSLLPPKKRLRFLW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011156`
TK1151 ID	TkA03G569450
OH-1004 ID	LXL04_011156
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011156

Location Chr02:159096020-159096760 (+)

Description Similar to At2g32645: B3 domain-containing protein At2g32645

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g27410`	Putative B3 domain-containing protein At2g27410.	No verified direct reference in this release
`At2g32645`	B3 domain-containing protein At2g32645.	No verified direct reference in this release
`At3g24850`	Putative B3 domain-containing protein At3g24850.	No verified direct reference in this release
`At2g31720`	B3 domain-containing protein At2g31720.	No verified direct reference in this release
`At3g25182`	B3 domain-containing protein At3g25182.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011156 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G27410

ath:AT2G31720

ath:AT2G32645

ath:AT3G24850

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.975

Rank 1 · LXL04_011156 · OH-1004

Cytoplasm0.078

Rank 2 · LXL04_011156 · OH-1004

Cell membrane0.019

Rank 3 · LXL04_011156 · OH-1004

Endoplasmic reticulum0.011

Rank 4 · LXL04_011156 · OH-1004

Mitochondrion0.009

Rank 5 · LXL04_011156 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03754.20At2g31720-like92-218 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011156	`PF03754.20`	At2g31720-like	92	218	2.3e-31	109.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XIP5`	Arabidopsis thaliana	Putative B3 domain-containing protein At2g27410	30.460%	Swiss-Prot	moderate database homology
`Q1G3B8`	Arabidopsis thaliana	B3 domain-containing protein At2g32645	37.209%	Swiss-Prot	weak database homology
`Q9LRX6`	Arabidopsis thaliana	Putative B3 domain-containing protein At3g24850	31.351%	Swiss-Prot	moderate database homology
`Q8RV83`	Arabidopsis thaliana	B3 domain-containing protein At2g31720	33.516%	Swiss-Prot	moderate database homology
`Q9LSF7`	Arabidopsis thaliana	B3 domain-containing protein At3g25182	32.738%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card