LXL04_011071 | RubberDandelionOmics

Gene overview

LXL04_011071

Reference: OH-1004 Chr: Chr02 Coordinates: 157478778-157481443 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

705 bp · LXL04_011071|LXL04_011071|OH1004|cDNA

ATGGACAGAAATCAAGAACCCAAACTCACCGAGATGAGGAATTTCAAGTACGGAGACCCAACTCTCGAGCGGTTCTTGATAGCAAGGTCCATGGATCCAAATAAAGCAGCAAAGATGTTCGTTTCATGGCAGAAATGGAGGGCTTCGTTTGTCCCATTAGGGTTCATACCTGATTCAGAAGTAATCGATCAATTAGAAGCTAAAAAGATATATTTACAAGGTTTATGTAAGGATGAGATCCCTGTTATGATTGTCAAAGC...

CDS

Download CDS FASTA

705 bp · LXL04_011071|LXL04_011071|OH1004|CDS

ATGGACAGAAATCAAGAACCCAAACTCACCGAGATGAGGAATTTCAAGTACGGAGACCCAACTCTCGAGCGGTTCTTGATAGCAAGGTCCATGGATCCAAATAAAGCAGCAAAGATGTTCGTTTCATGGCAGAAATGGAGGGCTTCGTTTGTCCCATTAGGGTTCATACCTGATTCAGAAGTAATCGATCAATTAGAAGCTAAAAAGATATATTTACAAGGTTTATGTAAGGATGAGATCCCTGTTATGATTGTCAAAGC...

Protein

Download Protein FASTA

234 aa · LXL04_011071|LXL04_011071|OH1004|PROTEIN

MDRNQEPKLTEMRNFKYGDPTLERFLIARSMDPNKAAKMFVSWQKWRASFVPLGFIPDSEVIDQLEAKKIYLQGLCKDEIPVMIVKASKHYPAKDQPQFKKFVVHLLDKVIASGYKGKEIGNEKLIGVLDLNQICYKNVDARGLITGFQFLQAYYPERLAKLYILNMPWFFVSIWKMVSRFLEKATLEKVVIVTNEEEKKQFIREVGEEVLPEEFGGNAKLIPIQDVILPSLED

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011071`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_011071`
Location	Chr02:157478778-157481443 (+)
Description	Similar to YKL091C: CRAL-TRIO domain-containing protein YKL091C (Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_011071` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006892 post-Golgi vesicle-mediated transport Biological Process GO:0006893 Golgi to plasma membrane transport Biological Process GO:0009395 phospholipid catabolic process Biological Process GO:0015031 protein transport Biological Process GO:0015914 phospholipid transport Biological Process GO:0043001 Golgi to plasma membrane protein transport Biological Process GO:0045717 negative regulation of fatty acid biosynthetic process Biological Process GO:0046488 phosphatidylinositol metabolic process Biological Process GO:0120010 intermembrane phospholipid transfer Biological Process GO:1901352 negative regulation of phosphatidylglycerol biosynthetic process Biological Process GO:2001247 positive regulation of phosphatidylcholine biosynthetic process Biological Process GO:0000139 Golgi membrane Cellular Component
KEGG gene cross-reference	kla:KLLA0_B06479g sce:YKL091C sce:YLR380W spo:2543628 yli:2910641 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.308

Rank 1 · LXL04_011071 · OH-1004

Endoplasmic reticulum0.275

Rank 2 · LXL04_011071 · OH-1004

Mitochondrion0.160

Rank 3 · LXL04_011071 · OH-1004

Peroxisome0.142

Rank 4 · LXL04_011071 · OH-1004

Nucleus0.099

Rank 5 · LXL04_011071 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00650.26CRAL_TRIO66-217 aa

PF13716.12CRAL_TRIO_281-216 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011071	`PF00650.26`	CRAL_TRIO	66	217	5.4e-27	95.2
LXL04_011071	`PF13716.12`	CRAL_TRIO_2	81	216	2.5e-08	35.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card