Gene Card
Gene overview
cDNA / CDS / Protein Sequences
288 bp · LXL04_011065|LXL04_011065|OH1004|cDNA
ATGGCGTACGTCGAAAGAGGCGTAGTGAAATCCAATCGATCTTTATGGCGTTTGAGAACAATCACTGATTTCTTTTGGGCAATCATCAATTTCATCTCTGTTTTCTTTGCCACAATGTTTTCGATGGAGAAATCTGATGGGTATAAGAAACAATCTGGTGCCACCAAGAAATGGGACGGGGGCGGCCCGGGTGGCGGCCCATATGGTGGTGGCCCACGTGGACTCGACAATGTTAGAGGCATAGACCACAGCTCTCTTCC...
288 bp · LXL04_011065|LXL04_011065|OH1004|CDS
ATGGCGTACGTCGAAAGAGGCGTAGTGAAATCCAATCGATCTTTATGGCGTTTGAGAACAATCACTGATTTCTTTTGGGCAATCATCAATTTCATCTCTGTTTTCTTTGCCACAATGTTTTCGATGGAGAAATCTGATGGGTATAAGAAACAATCTGGTGCCACCAAGAAATGGGACGGGGGCGGCCCGGGTGGCGGCCCATATGGTGGTGGCCCACGTGGACTCGACAATGTTAGAGGCATAGACCACAGCTCTCTTCC...
Protein
Download Protein FASTA95 aa · LXL04_011065|LXL04_011065|OH1004|PROTEIN
MAYVERGVVKSNRSLWRLRTITDFFWAIINFISVFFATMFSMEKSDGYKKQSGATKKWDGGGPGGGPYGGGPRGLDNVRGIDHSSLPACGSCCGG
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_011065 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_011065 |
|---|---|
| Location | Chr02:157379012-157380052 (+) |
| Description | Similar to SELENOK: Selenoprotein K |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0002230 positive regulation of defense response to virus by host Biological Process GO:0006816 calcium ion transport Biological Process GO:0006979 response to oxidative stress Biological Process GO:0018345 protein palmitoylation Biological Process GO:0030335 positive regulation of cell migration Biological Process GO:0032469 endoplasmic reticulum calcium ion homeostasis Biological Process GO:0032722 positive regulation of chemokine production Biological Process GO:0032760 positive regulation of tumor necrosis factor production Biological Process GO:0045728 respiratory burst after phagocytosis Biological Process GO:0050848 regulation of calcium-mediated signaling Biological Process GO:0051223 regulation of protein transport Biological Process GO:0071639 positive regulation of monocyte chemotactic protein-1 production Biological Process |
| KEGG gene cross-reference | hsa:58515 mmu:80795 rno:290549 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF10961.14SelK_SelG2-70 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_011065 | PF10961.14 | SelK_SelG | 2 | 70 | 2.1e-22 | 80.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.