LXL04_010987 | RubberDandelionOmics

Gene overview

LXL04_010987

Reference: OH-1004 Chr: Chr02 Coordinates: 156162845-156167933 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3498 bp · LXL04_010987|LXL04_010987|OH1004|cDNA

ATGTCGATTGATGGAGGTCCTCGTTTCAAGTCAATTAAATCGTTGCCAGTGGATTATAGGTTTATGGGTTCAGCCGAAAAGTCTACAACCAGTAGTACAAGCAGTATGATCTCTGTTACTATACCAGAGAACGGTAACATGGATCAGAttgttgatgatgattcaccaTATGGTCATAGTCACAGATCAACTTTGTTTATGAATGATAGACCTTCGATGGATGATGAAGATGTCAATCCGTCAGTTTCTCCTCAAGGATC...

CDS

Download CDS FASTA

3498 bp · LXL04_010987|LXL04_010987|OH1004|CDS

ATGTCGATTGATGGAGGTCCTCGTTTCAAGTCAATTAAATCGTTGCCAGTGGATTATAGGTTTATGGGTTCAGCCGAAAAGTCTACAACCAGTAGTACAAGCAGTATGATCTCTGTTACTATACCAGAGAACGGTAACATGGATCAGATTGTTGATGATGATTCACCATATGGTCATAGTCACAGATCAACTTTGTTTATGAATGATAGACCTTCGATGGATGATGAAGATGTCAATCCGTCAGTTTCTCCTCAAGGATC...

Protein

Download Protein FASTA

1165 aa · LXL04_010987|LXL04_010987|OH1004|PROTEIN

MSIDGGPRFKSIKSLPVDYRFMGSAEKSTTSSTSSMISVTIPENGNMDQIVDDDSPYGHSHRSTLFMNDRPSMDDEDVNPSVSPQGSVPSSWGETKWGDTASYNAKKKLQSWYQSSDGNWELAKILSISGNESLISFSEGKVLKVKSDSLLPANPEILDGVDDLMQLSYLNEPSVLYNLQYRYDRDMIYSKAGPVLVAINPFKKIPLYGSEYIEGYKSKSRDSPHVYAIADTAIREMIRDEVNQSIVISGESGAGKTETA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010987`
TK1151 ID	TkA03G559680
OH-1004 ID	LXL04_010987
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	97.500
Protein coverage (%)	TK1151 80.952 / OH-1004 10.043 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010987

Location Chr02:156162845-156167933 (+)

Description Similar to VIII-1: Myosin-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g19960`	Myosin heavy chain that is required for the cell cycle-regulated transport of various organelles and proteins for their segregation.	No verified direct reference in this release
`At1g50360`	Myosin heavy chain that is required for the cell cycle-regulated transport of various organelles and proteins for their segregation.	No verified direct reference in this release
`At5g54280`	Myosin heavy chain that is required for the cell cycle-regulated transport of various organelles and proteins for their segregation.	No verified direct reference in this release
`At4g27370`	Myosin heavy chain that is required for the cell cycle-regulated transport of various organelles and proteins for their segregation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010987 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006897 endocytosis Biological Process

GO:0007015 actin filament organization Biological Process

GO:0010082 regulation of root meristem growth Biological Process

GO:0030048 actin filament-based movement Biological Process

GO:0033275 actin-myosin filament sliding Biological Process

GO:0140027 contractile vacuole localization Biological Process

GO:0000331 contractile vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005768 endosome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G50360

ath:AT3G19960

ath:AT4G27370

ath:AT5G54280

ddi:DDB_G0272112

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.404

Rank 1 · LXL04_010987 · OH-1004

Cell membrane0.248

Rank 2 · LXL04_010987 · OH-1004

Nucleus0.227

Rank 3 · LXL04_010987 · OH-1004

Plastid0.154

Rank 4 · LXL04_010987 · OH-1004

Golgi apparatus0.061

Rank 5 · LXL04_010987 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25369.2SH3_VIII-1_N109-153 aa

PF00063.28Myosin_head161-819 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010987	`PF25369.2`	SH3_VIII-1_N	109	153	1.7e-22	79.2
LXL04_010987	`PF00063.28`	Myosin_head	161	819	1.8e-240	800.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LHE9`	Arabidopsis thaliana	Myosin-1	73.854%	Swiss-Prot	strong database homology
`F4I507`	Arabidopsis thaliana	Myosin-3	72.852%	Swiss-Prot	strong database homology
`F4K0A6`	Arabidopsis thaliana	Myosin-2	57.143%	Swiss-Prot	strong database homology
`F4JIU4`	Arabidopsis thaliana	Myosin-4	52.801%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card