LXL04_010970 | RubberDandelionOmics

Gene overview

LXL04_010970

Reference: OH-1004 Chr: Chr02 Coordinates: 155836177-155837876 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

819 bp · LXL04_010970|LXL04_010970|OH1004|cDNA

ATGATGCCATCAAGCGACCGTATGAGCTTACCGGTGTCGGATCCTCCTCCTCAGCAAAAAGGCGGCGCCGACGAACAGAGGCTCTTCAAAGGATCCACTATGACCTCTGGCGGTGCTTATGATGCCGTCTCTTACATGTCTTGCGCTGGTATTAAATCAAAGGACGAGTTATTGTATCAACAATGGATGGATAAAGAAGGAAAGACTCCTCTCATATTGGCTTCCATGAGTCCACAGCTATATGATGTTGCAAAAACCCT...

CDS

Download CDS FASTA

819 bp · LXL04_010970|LXL04_010970|OH1004|CDS

ATGATGCCATCAAGCGACCGTATGAGCTTACCGGTGTCGGATCCTCCTCCTCAGCAAAAAGGCGGCGCCGACGAACAGAGGCTCTTCAAAGGATCCACTATGACCTCTGGCGGTGCTTATGATGCCGTCTCTTACATGTCTTGCGCTGGTATTAAATCAAAGGACGAGTTATTGTATCAACAATGGATGGATAAAGAAGGAAAGACTCCTCTCATATTGGCTTCCATGAGTCCACAGCTATATGATGTTGCAAAAACCCT...

Protein

Download Protein FASTA

272 aa · LXL04_010970|LXL04_010970|OH1004|PROTEIN

MMPSSDRMSLPVSDPPPQQKGGADEQRLFKGSTMTSGGAYDAVSYMSCAGIKSKDELLYQQWMDKEGKTPLILASMSPQLYDVAKTLIKLGANVNAYRPGRHAGTPLHHAAKRGLEQMVKLLLSHGANALVMNDDCQTALDVARLKGYSNVERAIENHICLFSRWLQELYGPGFLELLAPQLLSRKMWVVILPCGARKLTKPFKLELAIYSGLQDAKPQSLLPLWKVNMDEPNFNQPDPIVIISSSNIPRRWRRRHVFCT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010970`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010970

Location Chr02:155836177-155837876 (-)

Description Similar to XBAT35: Putative E3 ubiquitin-protein ligase XBAT35

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g23280`	No E3 ubiquitin-protein ligase activity observed when associated with the E2 enzyme UBC8 in vitro.	No verified direct reference in this release
`At4g14365`	No E3 ubiquitin-protein ligase activity observed when associated with the E2 enzyme UBC8 in vitro.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0446100`	Probable E3 ubiquitin-protein ligase XBOS34.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010970 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0009609 response to symbiotic bacterium Biological Process

GO:0009610 response to symbiotic fungus Biological Process

GO:0009877 nodulation Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0036377 arbuscular mycorrhizal association Biological Process

GO:0043067 regulation of programmed cell death Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT3G23280

ath:AT4G14365

dosa:Os07g0446100

hsa:92591

mtr:25495843

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.457

Rank 1 · LXL04_010970 · OH-1004

Nucleus0.398

Rank 2 · LXL04_010970 · OH-1004

Cell membrane0.117

Rank 3 · LXL04_010970 · OH-1004

Mitochondrion0.114

Rank 4 · LXL04_010970 · OH-1004

Golgi apparatus0.064

Rank 5 · LXL04_010970 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13857.13Ank_587-143 aa

PF00023.37Ank105-133 aa

PF12796.14Ank_2105-151 aa

PF13637.13Ank_4107-147 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010970	`PF13857.13`	Ank_5	87	143	4.6e-08	34.0
LXL04_010970	`PF00023.37`	Ank	105	133	9.6e-14	51.5
LXL04_010970	`PF12796.14`	Ank_2	105	151	6.3e-13	49.8
LXL04_010970	`PF13637.13`	Ank_4	107	147	2.3e-09	38.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q4FE47`	Arabidopsis thaliana	Putative E3 ubiquitin-protein ligase XBAT35	64.000%	Swiss-Prot	strong database homology
`Q9FPH0`	Arabidopsis thaliana	Putative E3 ubiquitin-protein ligase XBAT34	57.339%	Swiss-Prot	strong database homology
`Q7XI08`	Oryza sativa subsp. japonica	Probable E3 ubiquitin-protein ligase XBOS34	56.744%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card