LXL04_010941 | RubberDandelionOmics

Gene overview

LXL04_010941

Reference: OH-1004 Chr: Chr02 Coordinates: 155381523-155381954 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

432 bp · LXL04_010941|LXL04_010941|OH1004|cDNA

ATGGATGATGGAGAGGTAGAACTCTCAGTCTCAGACCATCTCACAGGCGATTCGTCGAACACTTGGCGTGCACCACAAAAGCTTGAGGTTTCACTAGCCGATGGCTCCTTGAAGAACAGAAGAACGATTACAAAAACTCATGCTTCGGTTAAACCCGAGAAACCATCAGGAAATCGAGTTGCGGTTAAGAAGTATCGAGAGAAGAAGAAAGCGCAGAACGCTTATTTAGAGGAAGAAGTTAAGAAACTGCGGGTTTTGAA...

CDS

Download CDS FASTA

432 bp · LXL04_010941|LXL04_010941|OH1004|CDS

ATGGATGATGGAGAGGTAGAACTCTCAGTCTCAGACCATCTCACAGGCGATTCGTCGAACACTTGGCGTGCACCACAAAAGCTTGAGGTTTCACTAGCCGATGGCTCCTTGAAGAACAGAAGAACGATTACAAAAACTCATGCTTCGGTTAAACCCGAGAAACCATCAGGAAATCGAGTTGCGGTTAAGAAGTATCGAGAGAAGAAGAAAGCGCAGAACGCTTATTTAGAGGAAGAAGTTAAGAAACTGCGGGTTTTGAA...

Protein

Download Protein FASTA

143 aa · LXL04_010941|LXL04_010941|OH1004|PROTEIN

MDDGEVELSVSDHLTGDSSNTWRAPQKLEVSLADGSLKNRRTITKTHASVKPEKPSGNRVAVKKYREKKKAQNAYLEEEVKKLRVLNRGLIRKLQLQAALEAEAVRLRSLLQNLRAQIGNELSMSPFYKQNCDVSSDGCSDRD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010941`
TK1151 ID	TkA03G557100
OH-1004 ID	LXL04_010941
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010941

Location Chr02:155381523-155381954 (-)

Description Similar to BZIP23: Basic leucine zipper 23

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g16770`	Transcription factor involved in the response to zinc ion deficiency.	Arabidopsis thaliana transcription factors bZIP19 and bZIP23 regulate the adaptation to zinc deficiency.2010 · DOI: 10.1073/pnas.1004788107 Identification of putative target genes of bZIP19, a transcription factor essential for Arabidopsis adaptation to Zn deficiency in roots.2015 · DOI: 10.1111/tpj.12996
`At4g35040`	Transcription factor involved in the response to zinc ion deficiency.	Arabidopsis thaliana transcription factors bZIP19 and bZIP23 regulate the adaptation to zinc deficiency.2010 · DOI: 10.1073/pnas.1004788107 Identification of putative target genes of bZIP19, a transcription factor essential for Arabidopsis adaptation to Zn deficiency in roots.2015 · DOI: 10.1111/tpj.12996
`At3g51960`	Transcription factor involved in the regulation of salt stress response.	Differential transcript regulation in Arabidopsis thaliana and the halotolerant Lobularia maritima indicates genes with potential function in plant salt adaptation.2008 · DOI: 10.1016/j.gene.2008.07.017 The Arabidopsis basic leucine zipper transcription factor AtbZIP24 regulates complex transcriptional networks involved in abiotic stress resistance.2009 · DOI: 10.1016/j.gene.2009.02.010

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010941 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009651 response to salt stress Biological Process

GO:0010043 response to zinc ion Biological Process

GO:0042538 hyperosmotic salinity response Biological Process

GO:1901001 negative regulation of response to salt stress Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Molecular Function

KEGG gene cross-reference

ath:AT2G16770

ath:AT3G51960

ath:AT4G35040

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.960

Rank 1 · LXL04_010941 · OH-1004

Cytoplasm0.117

Rank 2 · LXL04_010941 · OH-1004

Cell membrane0.021

Rank 3 · LXL04_010941 · OH-1004

Endoplasmic reticulum0.010

Rank 4 · LXL04_010941 · OH-1004

Mitochondrion0.008

Rank 5 · LXL04_010941 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07716.21bZIP_257-101 aa

PF00170.27bZIP_158-95 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010941	`PF07716.21`	bZIP_2	57	101	1.1e-06	29.3
LXL04_010941	`PF00170.27`	bZIP_1	58	95	7.1e-06	26.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GTS2`	Arabidopsis thaliana	Basic leucine zipper 23	34.568%	Swiss-Prot	moderate database homology
`Q8VY76`	Arabidopsis thaliana	Basic leucine zipper 19	53.947%	Swiss-Prot	moderate database homology
`Q8GTS1`	Arabidopsis thaliana	Basic leucine zipper 24	50.000%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card