LXL04_010868 | RubberDandelionOmics

Gene overview

LXL04_010868

Reference: OH-1004 Chr: Chr02 Coordinates: 154482429-154482883 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

405 bp · LXL04_010868|LXL04_010868|OH1004|cDNA

ATGTTGGATTGGAAGACAAGGGTGAACATTATCAAACAGGTAGCTCATGTGTTGGAATACATGCATCATGATTACAGCCCACCCATCATTCATCGAGACATATCAAGCAAGAACATTCTCTTGAACTCTAAAATGGAAGGATTTGTTGCTGATTTTGGAGTAGCCAAAGTGCTCGACGCTAATGCCTCAATTAAGCTAGCATATAACATCATTGTGACCGAAAAATGTGATGTGTATAGCTTTGGGGTGTTGGCACTTGA...

CDS

Download CDS FASTA

405 bp · LXL04_010868|LXL04_010868|OH1004|CDS

ATGTTGGATTGGAAGACAAGGGTGAACATTATCAAACAGGTAGCTCATGTGTTGGAATACATGCATCATGATTACAGCCCACCCATCATTCATCGAGACATATCAAGCAAGAACATTCTCTTGAACTCTAAAATGGAAGGATTTGTTGCTGATTTTGGAGTAGCCAAAGTGCTCGACGCTAATGCCTCAATTAAGCTAGCATATAACATCATTGTGACCGAAAAATGTGATGTGTATAGCTTTGGGGTGTTGGCACTTGA...

Protein

Download Protein FASTA

134 aa · LXL04_010868|LXL04_010868|OH1004|PROTEIN

MLDWKTRVNIIKQVAHVLEYMHHDYSPPIIHRDISSKNILLNSKMEGFVADFGVAKVLDANASIKLAYNIIVTEKCDVYSFGVLALETLGGKHPGDLLMSLNSSNQHGATFESILDKSIPYPNDTPIENEILRV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010868`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010868

Location Chr02:154482429-154482883 (-)

Description Similar to MIK2: MDIS1-interacting receptor like kinase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g08850`	Acts as a receptor of SCOOP peptides from Brassicaceae plants regulating multiple processing including plant growth, development and stress responses.	A receptor heteromer mediates the male perception of female attractants in plants.2016 · DOI: 10.1038/nature16975 Perception of a divergent family of phytocytokines by the Arabidopsis receptor kinase MIK2.2021 · DOI: 10.1038/s41467-021-20932-y The Arabidopsis MIK2 receptor elicits immunity by sensing a conserved signature from phytocytokines and microbes.2021 · DOI: 10.1038/s41467-021-25580-w The MIK2/SCOOP Signaling System Contributes to Arabidopsis Resistance Against Herbivory by Modulating Jasmonate and Indole Glucosinolate Biosynthesis.2022 · DOI: 10.3389/fpls.2022.852808
`At1g35710`	Probable leucine-rich repeat receptor-like protein kinase At1g35710.	No verified direct reference in this release
`At1g31420`	Involved in the signaling pathway that regulates cell wall function, including cellulose biosynthesis, likely via an 1- aminocyclopropane-1-carboxylic acid (ACC)-mediated signal (a precursor of ethylene).	Two leucine-rich repeat receptor kinases mediate signaling, linking cell wall biosynthesis and ACC synthase in Arabidopsis.2008 · DOI: 10.1105/tpc.108.063354
`At5g49660`	Receptor kinase involved in the perception of C-terminally encoded plant signaling peptide (CEP) and subsequent regulation of root and shoot development.	XYLEM INTERMIXED WITH PHLOEM1, a leucine-rich repeat receptor-like kinase required for stem growth and vascular development in Arabidopsis thaliana.2012 · DOI: 10.1007/s00425-011-1489-6 CEP5 and XIP1/CEPR1 regulate lateral root initiation in Arabidopsis.2016 · DOI: 10.1093/jxb/erw231
`At4g20140`	Together with GSO2, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons.	GASSHO1 and GASSHO2 encoding a putative leucine-rich repeat transmembrane-type receptor kinase are essential for the normal development of the epidermal surface in Arabidopsis embryos.2008 · DOI: 10.1111/j.1365-313x.2007.03395.x The receptor-like kinases GSO1 and GSO2 together regulate root growth in Arabidopsis through control of cell division and cell fate specification.2014 · DOI: 10.1002/dvdy.24066 A peptide hormone required for Casparian strip diffusion barrier formation in Arabidopsis roots.2017 · DOI: 10.1126/science.aai9057

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010868 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002213 defense response to insect Biological Process

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0009611 response to wounding Biological Process

GO:0009664 plant-type cell wall organization Biological Process

GO:0009695 jasmonic acid biosynthetic process Biological Process

GO:0009755 hormone-mediated signaling pathway Biological Process

GO:0009759 indole glucosinolate biosynthetic process Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0010051 xylem and phloem pattern formation Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010311 lateral root formation Biological Process

GO:0031349 positive regulation of defense response Biological Process

KEGG gene cross-reference

ath:AT1G31420

ath:AT1G35710

ath:AT4G08850

ath:AT4G20140

ath:AT5G49660

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.430

Rank 1 · LXL04_010868 · OH-1004

Cytoplasm0.397

Rank 2 · LXL04_010868 · OH-1004

Nucleus0.170

Rank 3 · LXL04_010868 · OH-1004

Endoplasmic reticulum0.079

Rank 4 · LXL04_010868 · OH-1004

Lysosome / Vacuole0.033

Rank 5 · LXL04_010868 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714.24PK_Tyr_Ser-Thr3-94 aa

PF00069.32Pkinase7-107 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010868	`PF07714.24`	PK_Tyr_Ser-Thr	3	94	3.3e-13	50.3
LXL04_010868	`PF00069.32`	Pkinase	7	107	3.3e-13	50.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZG8`	Arabidopsis thaliana	MDIS1-interacting receptor like kinase 2	49.324%	Swiss-Prot	moderate database homology
`Q9LP24`	Arabidopsis thaliana	Probable leucine-rich repeat receptor-like protein kinase At1g35710	48.507%	Swiss-Prot	moderate database homology
`C0LGF4`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase FEI 1	49.541%	Swiss-Prot	moderate database homology
`Q9FGL5`	Arabidopsis thaliana	Receptor protein-tyrosine kinase CEPR1	48.182%	Swiss-Prot	moderate database homology
`C0LGQ5`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase GSO1	42.478%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card