LXL04_010843 | RubberDandelionOmics

Gene overview

LXL04_010843

Reference: OH-1004 Chr: Chr02 Coordinates: 154369744-154370842 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

945 bp · LXL04_010843|LXL04_010843|OH1004|cDNA

ATGAGAAAGCCCGACCAAAATGCAGGGAGATCGGACAAAGTTTGTAGCGATAGTAATGTTGTGAAGGGAATAAAGATGAAGGTTCGAAAGGGGTTATGGTCACCTGAAGAAGACGAAAAATTGATCAATTACATGTTGACTAATGGTCAAGGATGTTGGACGGATATAGCCAGGAATGCCGGGCTTCAAAGATGTGGAAAGAGTTGCCGCCTTCGTTGGATCAATTACTTGAGACCCGATCTCAAACGTGGTGCATTTTC...

CDS

Download CDS FASTA

945 bp · LXL04_010843|LXL04_010843|OH1004|CDS

ATGAGAAAGCCCGACCAAAATGCAGGGAGATCGGACAAAGTTTGTAGCGATAGTAATGTTGTGAAGGGAATAAAGATGAAGGTTCGAAAGGGGTTATGGTCACCTGAAGAAGACGAAAAATTGATCAATTACATGTTGACTAATGGTCAAGGATGTTGGACGGATATAGCCAGGAATGCCGGGCTTCAAAGATGTGGAAAGAGTTGCCGCCTTCGTTGGATCAATTACTTGAGACCCGATCTCAAACGTGGTGCATTTTC...

Protein

Download Protein FASTA

314 aa · LXL04_010843|LXL04_010843|OH1004|PROTEIN

MRKPDQNAGRSDKVCSDSNVVKGIKMKVRKGLWSPEEDEKLINYMLTNGQGCWTDIARNAGLQRCGKSCRLRWINYLRPDLKRGAFSPQEQDIILHLHSILGNRWSQIAARLPGRTDNEIKNFWNSTRKKRLKTTMSDTSTTLPNDNVEGGNGIFMSTHDHDMMTMSIDSCLPISPTTTSSSMQNNTDGHHQFGHLPPLVYDNKDYGTHGGSNFLNISGYGDVIEVPNMFGMEYDITNHDQVYNSVIEGDAHANIHHHEK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010843`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010843

Location Chr02:154369744-154370842 (+)

Description Similar to MYB83: Transcription factor MYB83

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g08500`	Transcription factor that acts as a molecular switch in the NAC012/SND1-mediated transcriptional network regulating secondary wall biosynthesis.	MYB83 is a direct target of SND1 and acts redundantly with MYB46 in the regulation of secondary cell wall biosynthesis in Arabidopsis.2009 · DOI: 10.1093/pcp/pcp139 MYB46 and MYB83 bind to the SMRE sites and directly activate a suite of transcription factors and secondary wall biosynthetic genes.2012 · DOI: 10.1093/pcp/pcr185
`At5g12870`	Transcription activator.	The MYB46 transcription factor is a direct target of SND1 and regulates secondary wall biosynthesis in Arabidopsis.2007 · DOI: 10.1105/tpc.107.053678 MYB83 is a direct target of SND1 and acts redundantly with MYB46 in the regulation of secondary cell wall biosynthesis in Arabidopsis.2009 · DOI: 10.1093/pcp/pcp139 MYB46 and MYB83 bind to the SMRE sites and directly activate a suite of transcription factors and secondary wall biosynthetic genes.2012 · DOI: 10.1093/pcp/pcr185 Transcription factor MYB46 is an obligate component of the transcriptional regulatory complex for functional expression of secondary wall-associated cellulose synthases in Arabidopsis thaliana.2013 · DOI: 10.1016/j.jplph.2013.04.012 Transcription factors that directly regulate the expression of CSLA9 encoding mannan synthase in Arabidopsis thaliana.2014 · DOI: 10.1007/s11103-013-0154-9
`At1g09540`	Transcription factor that coordinates a small network of downstream target genes required for several aspects of plant growth and development, such as xylem formation and xylem cell differentiation, and lateral root formation.	AtMYB61, an R2R3-MYB transcription factor controlling stomatal aperture in Arabidopsis thaliana.2005 · DOI: 10.1016/j.cub.2005.06.041 MUM ENHANCERS are important for seed coat mucilage production and mucilage secretory cell differentiation in Arabidopsis thaliana.2009 · DOI: 10.1093/jxb/erp102 AtMYB61, an R2R3-MYB transcription factor, functions as a pleiotropic regulator via a small gene network.2012 · DOI: 10.1111/j.1469-8137.2012.04201.x Interactions between the R2R3-MYB transcription factor, AtMYB61, and target DNA binding sites.2013 · DOI: 10.1371/journal.pone.0065132 AaMYB1 and its orthologue AtMYB61 affect terpene metabolism and trichome development in Artemisia annua and Arabidopsis thaliana.2017 · DOI: 10.1111/tpj.13509
`At5g26660`	Probable transcription factor.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010843 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0010089 xylem development Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0010214 seed coat development Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048364 root development Biological Process

GO:0050832 defense response to fungus Biological Process

GO:1901348 positive regulation of secondary cell wall biogenesis Biological Process

KEGG gene cross-reference

ath:AT1G09540

ath:AT3G08500

ath:AT5G12870

ath:AT5G26660

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.977

Rank 1 · LXL04_010843 · OH-1004

Cytoplasm0.090

Rank 2 · LXL04_010843 · OH-1004

Cell membrane0.021

Rank 3 · LXL04_010843 · OH-1004

Endoplasmic reticulum0.013

Rank 4 · LXL04_010843 · OH-1004

Plastid0.009

Rank 5 · LXL04_010843 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249.38Myb_DNA-binding30-77 aa

PF13921.13Myb_DNA-bind_633-91 aa

PF00249.38Myb_DNA-binding83-126 aa

PF13921.13Myb_DNA-bind_686-138 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010843	`PF00249.38`	Myb_DNA-binding	30	77	5.4e-34	116.8
LXL04_010843	`PF13921.13`	Myb_DNA-bind_6	33	91	2.4e-21	76.4
LXL04_010843	`PF00249.38`	Myb_DNA-binding	83	126	5.4e-34	116.8
LXL04_010843	`PF13921.13`	Myb_DNA-bind_6	86	138	2.4e-21	76.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C6U1`	Arabidopsis thaliana	Transcription factor MYB83	44.068%	Swiss-Prot	moderate database homology
`Q9LXV2`	Arabidopsis thaliana	Transcription factor MYB46	73.381%	Swiss-Prot	weak database homology
`Q8VZQ2`	Arabidopsis thaliana	Transcription factor MYB61	68.000%	Swiss-Prot	weak database homology
`Q8LPH6`	Arabidopsis thaliana	Transcription factor MYB86	69.421%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card