LXL04_010786 | RubberDandelionOmics

Gene overview

LXL04_010786

Reference: OH-1004 Chr: Chr02 Coordinates: 153467908-153472304 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2877 bp · LXL04_010786|LXL04_010786|OH1004|cDNA

ATGATTGAACCGATGGTACGATCAAAAATGCCGAATGTTAAACGCTGCAAATTGGAGGAAATTGACGCCGATACGACTGACAATTCGCATTCACATTACCCTTCTGTGGGTTTCACCAAGAAACAAAGAACAAACACCGCGTTCGTGGCAACTGCCGATAAGGAAGCCTGTTTTATCGACTACGAAAACGTCGTTAACGCTTGGTGCACTGGAGTTCCGTGTACCCCTGCCGATTTGAAGTCAAGTTCGAGTTCAATTAA...

CDS

Download CDS FASTA

2877 bp · LXL04_010786|LXL04_010786|OH1004|CDS

ATGATTGAACCGATGGTACGATCAAAAATGCCGAATGTTAAACGCTGCAAATTGGAGGAAATTGACGCCGATACGACTGACAATTCGCATTCACATTACCCTTCTGTGGGTTTCACCAAGAAACAAAGAACAAACACCGCGTTCGTGGCAACTGCCGATAAGGAAGCCTGTTTTATCGACTACGAAAACGTCGTTAACGCTTGGTGCACTGGAGTTCCGTGTACCCCTGCCGATTTGAAGTCAAGTTCGAGTTCAATTAA...

Protein

Download Protein FASTA

958 aa · LXL04_010786|LXL04_010786|OH1004|PROTEIN

MIEPMVRSKMPNVKRCKLEEIDADTTDNSHSHYPSVGFTKKQRTNTAFVATADKEACFIDYENVVNAWCTGVPCTPADLKSSSSSIKLLKSSRGRLSVCPSRFNDTVIGLWKKENDIDTNIRKRKFPFSDRESVSKKQSMEPKVGQMFSSSSSSATSFGNHISNDSKKARKTTKNVKRKESYTHQDFLTGEIVWAKCSNRFPAWPAIVIDAQQEAPTSVKKARIPNTVCVMFYGYSKRGTRDYAWVKDGMIYPFLEFLER...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010786`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010786

Location Chr02:153467908-153472304 (-)

Description Similar to ATX3: Histone-lysine N-methyltransferase ATX3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g61740`	Histone methyltransferase.	No verified direct reference in this release
`At5g53430`	Histone methyltransferase.	No verified direct reference in this release
`At4g27910`	Histone methyltransferase.	No verified direct reference in this release
`At1g05830`	Histone methyltransferase.	The highly similar Arabidopsis homologs of trithorax ATX1 and ATX2 encode proteins with divergent biochemical functions.2008 · DOI: 10.1105/tpc.107.056614 Combinatorial functions of diverse histone methylations in Arabidopsis thaliana flowering time regulation.2014 · DOI: 10.1111/nph.12493

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0134500`	Possesses histone H3 methyltransferase activity in vitro.	Trithorax group protein Oryza sativa Trithorax1 controls flowering time in rice via interaction with early heading date3.2014 · DOI: 10.1104/pp.113.228049

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010786 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006338 chromatin remodeling Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009294 DNA-mediated transformation Biological Process

GO:0009908 flower development Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0032259 methylation Biological Process

GO:0040029 epigenetic regulation of gene expression Biological Process

GO:0048578 positive regulation of long-day photoperiodism, flowering Biological Process

GO:0000785 chromatin Cellular Component

GO:0005634 nucleus Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT1G05830

ath:AT3G61740

ath:AT4G27910

ath:AT5G53430

dosa:Os09g0134500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.898

Rank 1 · LXL04_010786 · OH-1004

Cytoplasm0.154

Rank 2 · LXL04_010786 · OH-1004

Cell membrane0.031

Rank 3 · LXL04_010786 · OH-1004

Mitochondrion0.021

Rank 4 · LXL04_010786 · OH-1004

Endoplasmic reticulum0.013

Rank 5 · LXL04_010786 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00855.24PWWP190-282 aa

PF13831.13PHD_2542-576 aa

PF13832.13zf-HC5HC2H_2583-695 aa

PF13771.13zf-HC5HC2H605-696 aa

PF00856.34SET827-933 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010786	`PF00855.24`	PWWP	190	282	4.4e-17	63.1
LXL04_010786	`PF13831.13`	PHD_2	542	576	2.1e-13	50.2
LXL04_010786	`PF13832.13`	zf-HC5HC2H_2	583	695	1e-28	100.4
LXL04_010786	`PF13771.13`	zf-HC5HC2H	605	696	3.8e-13	50.1
LXL04_010786	`PF00856.34`	SET	827	933	1.9e-25	90.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M364`	Arabidopsis thaliana	Histone-lysine N-methyltransferase ATX3	49.263%	Swiss-Prot	moderate database homology
`Q8GZ42`	Arabidopsis thaliana	Histone-lysine N-methyltransferase ATX5	46.612%	Swiss-Prot	moderate database homology
`Q9SUE7`	Arabidopsis thaliana	Histone-lysine N-methyltransferase ATX4	48.394%	Swiss-Prot	moderate database homology
`P0CB22`	Arabidopsis thaliana	Histone-lysine N-methyltransferase ATX2	32.059%	Swiss-Prot	weak database homology
`Q6K431`	Oryza sativa subsp. japonica	Histone-lysine N-methyltransferase TRX1	34.115%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card