LXL04_010736 | RubberDandelionOmics

Gene overview

LXL04_010736

Reference: OH-1004 Chr: Chr02 Coordinates: 152424231-152428762 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1932 bp · LXL04_010736|LXL04_010736|OH1004|cDNA

ATCGGATGTTGCCTAATTCGAGCGTTTCATCAAAGAAGAAACAACCATCGGAACCTGGGAAGAAAAATTGCGTGGATGAAATGTTAAACATCTTCGTGCTAATACTGCGGGTGGTTAATAATGGTGATGCTACAAATTTTTGGACTCACGTGTGGTGTGGAGGAAATTCTTTAGCCTTGTCTTTTCCGAGACTTTTTGCGATGACTTCTAATCAGCGGGCTACCGTGGCGGAGTATCGAAGTGCTACAGGTTGGAATTTT...

CDS

Download CDS FASTA

1920 bp · LXL04_010736|LXL04_010736|OH1004|CDS

ATGTTGCCTAATTCGAGCGTTTCATCAAAGAAGAAACAACCATCGGAACCTGGGAAGAAAAATTGCGTGGATGAAATGTTAAACATCTTCGTGCTAATACTGCGGGTGGTTAATAATGGTGATGCTACAAATTTTTGGACTCACGTGTGGTGTGGAGGAAATTCTTTAGCCTTGTCTTTTCCGAGACTTTTTGCGATGACTTCTAATCAGCGGGCTACCGTGGCGGAGTATCGAAGTGCTACAGGTTGGAATTTTGCTTG...

Protein

Download Protein FASTA

639 aa · LXL04_010736|LXL04_010736|OH1004|PROTEIN

MLPNSSVSSKKKQPSEPGKKNCVDEMLNIFVLILRVVNNGDATNFWTHVWCGGNSLALSFPRLFAMTSNQRATVAEYRSATGWNFAWRGVVHFKNRWSIFKRNSRWSLFKMVLNVDAWRWDLSTDEMFSVESGRSHIDLTALPAINIMVRWVKFLPRKVNVFLWRLLLNRLPTRWSLNARGVPSDNNMCPVCAVAPEQVSHLFFGCSLAMDLWEKVRRWCQVQIPIFASLEEAWDWIDVQQGRSNQKVVLEVLIGSLLWI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010736`
TK1151 ID	TkA03G545840
OH-1004 ID	LXL04_010736
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.700
Protein coverage (%)	TK1151 95.291 / OH-1004 53.991 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010736

Location Chr02:152424231-152428762 (-)

Description Similar to KPHMT2: 3-methyl-2-oxobutanoate hydroxymethyltransferase 2, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g61530`	Catalyzes the reversible reaction in which hydroxymethyl group from 5,10-methylenetetrahydrofolate is transferred onto alpha-ketoisovalerate to form ketopantoate.	No verified direct reference in this release
`At2g46110`	Catalyzes the reversible reaction in which hydroxymethyl group from 5,10-methylenetetrahydrofolate is transferred onto alpha-ketoisovalerate to form ketopantoate.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0225400`	Catalyzes the reversible reaction in which hydroxymethyl group from 5,10-methylenetetrahydrofolate is transferred onto alpha-ketoisovalerate to form ketopantoate.	No verified direct reference in this release
`Os01g0225500`	Catalyzes the reversible reaction in which hydroxymethyl group from 5,10-methylenetetrahydrofolate is transferred onto alpha-ketoisovalerate to form ketopantoate.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010736 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0015940 pantothenate biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0003864 3-methyl-2-oxobutanoate hydroxymethyltransferase activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0050897 cobalt ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G46110

ath:AT3G61530

chy:CHY_2377

dosa:Os01g0225400

osa:107275880

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.467

Rank 1 · LXL04_010736 · OH-1004

Nucleus0.268

Rank 2 · LXL04_010736 · OH-1004

Mitochondrion0.113

Rank 3 · LXL04_010736 · OH-1004

Peroxisome0.113

Rank 4 · LXL04_010736 · OH-1004

Cell membrane0.073

Rank 5 · LXL04_010736 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13966.12zf-RVT148-213 aa

PF02548.22Pantoate_transf327-590 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010736	`PF13966.12`	zf-RVT	148	213	1.4e-14	55.2
LXL04_010736	`PF02548.22`	Pantoate_transf	327	590	1.9e-103	346.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M315`	Arabidopsis thaliana	3-methyl-2-oxobutanoate hydroxymethyltransferase 2, mitochondrial	81.707%	Swiss-Prot	moderate database homology
`O82357`	Arabidopsis thaliana	3-methyl-2-oxobutanoate hydroxymethyltransferase 1, mitochondrial	82.716%	Swiss-Prot	moderate database homology
`Q9AWZ8`	Oryza sativa subsp. japonica	3-methyl-2-oxobutanoate hydroxymethyltransferase 1, mitochondrial	78.614%	Swiss-Prot	moderate database homology
`Q9AWZ7`	Oryza sativa subsp. japonica	3-methyl-2-oxobutanoate hydroxymethyltransferase 2, mitochondrial	69.427%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card