LXL04_010619 | RubberDandelionOmics

Gene overview

LXL04_010619

Reference: OH-1004 Chr: Chr02 Coordinates: 149717729-149719139 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

846 bp · LXL04_010619|LXL04_010619|OH1004|cDNA

ATGCCAGCACTCGCTACTTCCCTTCGTCTCTTCCCCAATAATCCAATTTTACGCACAAAGCCATCTTTCCCCAATTTTTCTGCAACAATCCCATTTGGGTTCTCCGCTTCATCAACTTCTTACCCAATCAACAGTAATTCTTCTTTATCTTTCGTCGCTCCTCTTGAAGCAATACTTTTCGACATTGATGGAACTCTCTGTGACTCCGACCCTCTCCATTACTACGCCTTTCGTGATATGCTTCAAGAGATAGGATTTAA...

CDS

Download CDS FASTA

846 bp · LXL04_010619|LXL04_010619|OH1004|CDS

ATGCCAGCACTCGCTACTTCCCTTCGTCTCTTCCCCAATAATCCAATTTTACGCACAAAGCCATCTTTCCCCAATTTTTCTGCAACAATCCCATTTGGGTTCTCCGCTTCATCAACTTCTTACCCAATCAACAGTAATTCTTCTTTATCTTTCGTCGCTCCTCTTGAAGCAATACTTTTCGACATTGATGGAACTCTCTGTGACTCCGACCCTCTCCATTACTACGCCTTTCGTGATATGCTTCAAGAGATAGGATTTAA...

Protein

Download Protein FASTA

281 aa · LXL04_010619|LXL04_010619|OH1004|PROTEIN

MPALATSLRLFPNNPILRTKPSFPNFSATIPFGFSASSTSYPINSNSSLSFVAPLEAILFDIDGTLCDSDPLHYYAFRDMLQEIGFNDGSPIDEEFFINNISGKHNEELCRVLLPDWEFQKAMNFMVDKEALFRRLAAEQLEPISGLDNLCKWVEDQGLKRAAVTNAPKSNAELLISMLKLNDFFEVIVLAEECARAKPFPDPYLKALNALKVSPNHTFVFEDSVSGIKAANGAGMAAVGMATRNPEKMLLDAGATLVIK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010619`
TK1151 ID	TkA03G537360
OH-1004 ID	LXL04_010619
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010619

Location Chr02:149717729-149719139 (-)

Description Similar to SGPP: Haloacid dehalogenase-like hydrolase domain-containing protein Sgpp

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g38740`	May catalyze dephosphorylation of diverse sugar-phosphate substrates.	HAD hydrolase function unveiled by substrate screening: enzymatic characterization of Arabidopsis thaliana subclass I phosphosugar phosphatase AtSgpp.2013 · DOI: 10.1007/s00425-012-1809-5

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010619 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006281 DNA repair Biological Process

GO:0046295 glycolate biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0008801 beta-phosphoglucomutase activity Molecular Function

GO:0008967 phosphoglycolate phosphatase activity Molecular Function

GO:0016787 hydrolase activity Molecular Function

GO:0016791 phosphatase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G38740

ecj:JW2665

eco:b2690

ecoc:C3026_14810

noc:Noc_2493

tma:TM1254

tmi:THEMA_08065

tmm:Tmari_1259

tmw:THMA_1279

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.973

Rank 1 · LXL04_010619 · OH-1004

Mitochondrion0.043

Rank 2 · LXL04_010619 · OH-1004

Cytoplasm0.028

Rank 3 · LXL04_010619 · OH-1004

Nucleus0.021

Rank 4 · LXL04_010619 · OH-1004

Peroxisome0.016

Rank 5 · LXL04_010619 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00702.33Hydrolase56-235 aa

PF13419.13HAD_258-240 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010619	`PF00702.33`	Hydrolase	56	235	1.5e-24	88.2
LXL04_010619	`PF13419.13`	HAD_2	58	240	1.5e-29	103.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZVJ5`	Arabidopsis thaliana	Haloacid dehalogenase-like hydrolase domain-containing protein Sgpp	56.652%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card