LXL04_010503 | RubberDandelionOmics

Gene overview

LXL04_010503

Reference: OH-1004 Chr: Chr02 Coordinates: 147886201-147888609 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1872 bp · LXL04_010503|LXL04_010503|OH1004|cDNA

ATGTCTCTCATGGAAGGAGTAGAACACTTGAAAATTCGACTAGAAGACATAAAGTTGGCCACCAATAACTTTGACGATGACAATTTCATTGCACACGGTGGATTTGGGAAGGTCTACAAAGGCGAACTCACCCTATCCGGGCAATTAACCACAGTTGCAGTTAAAAGACTAGACCGTACATTTGGACAAGGTCACCGCGAGTTCTTAATGGAAATTCAAATGCTTTCATGCTATAGGCACAAGAACCTCATCTCTCTTAT...

CDS

Download CDS FASTA

1872 bp · LXL04_010503|LXL04_010503|OH1004|CDS

ATGTCTCTCATGGAAGGAGTAGAACACTTGAAAATTCGACTAGAAGACATAAAGTTGGCCACCAATAACTTTGACGATGACAATTTCATTGCACACGGTGGATTTGGGAAGGTCTACAAAGGCGAACTCACCCTATCCGGGCAATTAACCACAGTTGCAGTTAAAAGACTAGACCGTACATTTGGACAAGGTCACCGCGAGTTCTTAATGGAAATTCAAATGCTTTCATGCTATAGGCACAAGAACCTCATCTCTCTTAT...

Protein

Download Protein FASTA

623 aa · LXL04_010503|LXL04_010503|OH1004|PROTEIN

MSLMEGVEHLKIRLEDIKLATNNFDDDNFIAHGGFGKVYKGELTLSGQLTTVAVKRLDRTFGQGHREFLMEIQMLSCYRHKNLISLIGFCDEGKENILVYEHAEHGSLDKYLSDSQLSWMQRLEISLGAARGFSYLHNDVGPQHRVLHRDIKSSNILLSENWEVKISDFGLSKIGPSNVEFTFLVTNACGTFGYVDPQYLKTGILTKESDVYSFGVVLFEILCGRLAIVDKYQDERRFLASLAQLYYEHNKLNEIIFENL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010503`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010503

Location Chr02:147886201-147888609 (+)

Description Similar to At5g39000: Putative receptor-like protein kinase At5g39000

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g39000`	Putative receptor-like protein kinase At5g39000.	No verified direct reference in this release
`At3g46290`	Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.	Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106
`At3g04690`	Receptor-like protein kinase that controls pollen tube behavior by directing rupture at proper timing to release the sperm cell.	No verified direct reference in this release
`At3g51550`	May regulate MLO7 polarization in female gametophyte synergid cells to control pollen tube growth and male gamete delivery during fertilization.	FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development.2010 · DOI: 10.1073/pnas.1005366107
`At5g59700`	Probable receptor-like protein kinase At5g59700.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010503 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009723 response to ethylene Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010038 response to metal ion Biological Process

GO:0010118 stomatal movement Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010483 pollen tube reception Biological Process

KEGG gene cross-reference

ath:AT3G04690

ath:AT3G46290

ath:AT3G51550

ath:AT5G39000

ath:AT5G59700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.670

Rank 1 · LXL04_010503 · OH-1004

Nucleus0.289

Rank 2 · LXL04_010503 · OH-1004

Cell membrane0.172

Rank 3 · LXL04_010503 · OH-1004

Lysosome / Vacuole0.056

Rank 4 · LXL04_010503 · OH-1004

Endoplasmic reticulum0.055

Rank 5 · LXL04_010503 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase28-295 aa

PF07714.24PK_Tyr_Ser-Thr30-297 aa

PF01419.23Jacalin336-465 aa

PF01419.23Jacalin486-618 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010503	`PF00069.32`	Pkinase	28	295	4.5e-43	148.3
LXL04_010503	`PF07714.24`	PK_Tyr_Ser-Thr	30	297	5.7e-46	157.6
LXL04_010503	`PF01419.23`	Jacalin	336	465	1.1e-40	139.9
LXL04_010503	`PF01419.23`	Jacalin	486	618	1.1e-40	139.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FID8`	Arabidopsis thaliana	Putative receptor-like protein kinase At5g39000	46.102%	Swiss-Prot	weak database homology
`Q9LX66`	Arabidopsis thaliana	Receptor-like protein kinase HERK 1	47.811%	Swiss-Prot	weak database homology
`Q9SR05`	Arabidopsis thaliana	Receptor-like protein kinase ANXUR1	46.801%	Swiss-Prot	weak database homology
`Q9SCZ4`	Arabidopsis thaliana	Receptor-like protein kinase FERONIA	44.625%	Swiss-Prot	weak database homology
`Q9FN92`	Arabidopsis thaliana	Probable receptor-like protein kinase At5g59700	48.148%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card