LXL04_010484 | RubberDandelionOmics

Gene overview

LXL04_010484

Reference: OH-1004 Chr: Chr02 Coordinates: 147605063-147605551 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

489 bp · LXL04_010484|LXL04_010484|OH1004|cDNA

ATGAAAATTCGAGGGTTTTTGATCAAGCATAGAGTTAATTCTCTTTTCCGGCGAGGTTACCGCAGGACTCAATCGCCGGCAGGGTACAAACGGCTTGACGGGTCTCCGAGGGGGATGTCAAATTTCTTGAAGAAGTGGGGTGCCCGGCTCAAGACGAAAGCAATAGCTTTGTGTTCGAAACACTCCGGTCTTCCACGGAACCCGGTTCTTGAAAAGGATATGGAGCCGCGGCGGGCGGCGGTGCCGAAGGGGAAGATGGC...

CDS

Download CDS FASTA

489 bp · LXL04_010484|LXL04_010484|OH1004|CDS

ATGAAAATTCGAGGGTTTTTGATCAAGCATAGAGTTAATTCTCTTTTCCGGCGAGGTTACCGCAGGACTCAATCGCCGGCAGGGTACAAACGGCTTGACGGGTCTCCGAGGGGGATGTCAAATTTCTTGAAGAAGTGGGGTGCCCGGCTCAAGACGAAAGCAATAGCTTTGTGTTCGAAACACTCCGGTCTTCCACGGAACCCGGTTCTTGAAAAGGATATGGAGCCGCGGCGGGCGGCGGTGCCGAAGGGGAAGATGGC...

Protein

Download Protein FASTA

162 aa · LXL04_010484|LXL04_010484|OH1004|PROTEIN

MKIRGFLIKHRVNSLFRRGYRRTQSPAGYKRLDGSPRGMSNFLKKWGARLKTKAIALCSKHSGLPRNPVLEKDMEPRRAAVPKGKMAVYVGQKDGDYKRVLVPVIYINHPLFGQLLREAEEEYGHDHPGGITIPCRFSDFENVKTRIASVCGVRRMLTWNRS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010484`
TK1151 ID	TkA03G530410
OH-1004 ID	LXL04_010484
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010484

Location Chr02:147605063-147605551 (+)

Description Similar to SAUR36: Auxin-responsive protein SAUR36

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g45210`	Acts a positive regulator of leaf senescence and may mediate auxin-induced leaf senescence.	SAUR36, a small auxin up RNA gene, is involved in the promotion of leaf senescence in Arabidopsis.2013 · DOI: 10.1104/pp.112.212787 Auxin and gibberellin responsive Arabidopsis SMALL AUXIN UP RNA36 regulates hypocotyl elongation in the light.2013 · DOI: 10.1007/s00299-013-1406-5
`At4g38850`	Functions as a positive effector of cell expansion through modulation of auxin transport.	No verified direct reference in this release
`At2g46690`	May play a role in the apical hook development (Ref.7).	No verified direct reference in this release
`At5g18080`	Functions as a positive effector of cell expansion through modulation of auxin transport.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010484 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0010029 regulation of seed germination Biological Process

GO:1900057 positive regulation of leaf senescence Biological Process

GO:1900140 regulation of seedling development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT2G45210

ath:AT2G46690

ath:AT4G38850

ath:AT5G18080

gmx:100775873

gmx:100817568

gmx:106798973

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.401

Rank 1 · LXL04_010484 · OH-1004

Cell membrane0.336

Rank 2 · LXL04_010484 · OH-1004

Nucleus0.335

Rank 3 · LXL04_010484 · OH-1004

Endoplasmic reticulum0.077

Rank 4 · LXL04_010484 · OH-1004

Plastid0.041

Rank 5 · LXL04_010484 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02519.21Auxin_inducible42-147 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010484	`PF02519.21`	Auxin_inducible	42	147	2.7e-19	69.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22150`	Arabidopsis thaliana	Auxin-responsive protein SAUR36	48.485%	Swiss-Prot	moderate database homology
`Q41220`	Arabidopsis thaliana	Auxin-responsive protein SAUR15	55.714%	Swiss-Prot	weak database homology
`Q9ZUZ3`	Arabidopsis thaliana	Auxin-responsive protein SAUR32	53.731%	Swiss-Prot	weak database homology
`Q9FK62`	Arabidopsis thaliana	Auxin-responsive protein SAUR24	54.286%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card