LXL04_010481 | RubberDandelionOmics

Gene overview

LXL04_010481

Reference: OH-1004 Chr: Chr02 Coordinates: 147574145-147575974 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

826 bp · LXL04_010481|LXL04_010481|OH1004|cDNA

AGAGAGCAGCAAAGCAACACAGATTTGCTTCCATTTCAATATTCAACTGGAATTTCGTCTACAAATACCATATCATCAACACAAATCGACGATAGCGGCGGAGTGGATCGGATCCAAGTGTATGATGGATCAGGAATCGGGTTGGGAAGAACTAAGGAAAGAAGCTCGTAAGATCGAAGGCGATCTTGATGTTAAGCTCTCCTCTTATGCTAAGCTCGGCGCTCGTGTCACTCAAGGAGGTTTTGCAGATGCTGATACAC...

CDS

Download CDS FASTA

780 bp · LXL04_010481|LXL04_010481|OH1004|CDS

CTGGAATTTCGTCTACAAATACCATATCATCAACACAAATCGACGATAGCGGCGGAGTGGATCGGATCCAAGTGTATGATGGATCAGGAATCGGGTTGGGAAGAACTAAGGAAAGAAGCTCGTAAGATCGAAGGCGATCTTGATGTTAAGCTCTCCTCTTATGCTAAGCTCGGCGCTCGTGTCACTCAAGGAGGTTTTGCAGATGCTGATACACCAACAATGGGGTCCAACCGTTCATGGAAGTCAATGGAGATGGAAAT...

Protein

Download Protein FASTA

259 aa · LXL04_010481|LXL04_010481|OH1004|PROTEIN

MEFRLQIPYHQHKSTIAAEWIGSKCMMDQESGWEELRKEARKIEGDLDVKLSSYAKLGARVTQGGFADADTPTMGSNRSWKSMEMEIQSLLEKLLDVNDSMSRCAASAAPTTSVTQKLARHRDILHEFSQEFRRIKGNISAMTEHAELLSSVRDDISEYKASGSMSPRMQILRERAAIHGSIAHMDDVITQAQTTRAALGSQRTMFGDVQGKVKQLSDRFPIVRGLIGSIKRKKSRDTLILSAVIAACTLFLIIYWLSK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010481`
TK1151 ID	TkA03G530190
OH-1004 ID	LXL04_010481
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 90.347 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010481

Location Chr02:147574145-147575974 (+)

Description Similar to GOS12: Golgi SNAP receptor complex member 1-2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g45200`	Involved in transport from the ER to the Golgi apparatus as well as in intra-Golgi transport.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010481 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process

GO:0006891 intra-Golgi vesicle-mediated transport Biological Process

GO:0006906 vesicle fusion Biological Process

GO:0015031 protein transport Biological Process

GO:0042147 retrograde transport, endosome to Golgi Biological Process

GO:0048219 inter-Golgi cisterna vesicle-mediated transport Biological Process

GO:0000138 Golgi trans cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005768 endosome Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT2G45200

bta:511030

cge:100689312

mmu:53334

rno:94189

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.627

Rank 1 · LXL04_010481 · OH-1004

Endoplasmic reticulum0.243

Rank 2 · LXL04_010481 · OH-1004

Cytoplasm0.181

Rank 3 · LXL04_010481 · OH-1004

Nucleus0.090

Rank 4 · LXL04_010481 · OH-1004

Lysosome / Vacuole0.071

Rank 5 · LXL04_010481 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27017.1GOSR1_N32-160 aa

PF12352.14V-SNARE_C170-234 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010481	`PF27017.1`	GOSR1_N	32	160	8.2e-35	120.7
LXL04_010481	`PF12352.14`	V-SNARE_C	170	234	4.9e-16	59.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22151`	Arabidopsis thaliana	Golgi SNAP receptor complex member 1-2	78.715%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card