LXL04_010467 | RubberDandelionOmics

Gene overview

LXL04_010467

Reference: OH-1004 Chr: Chr02 Coordinates: 147190794-147193408 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1017 bp · LXL04_010467|LXL04_010467|OH1004|cDNA

ATGGATGCCAAGCAAACAGGCTTGTCACTTGATTCTTTAGTGTCATCCTTCAACACTCGCATTGCAGAGCTACAAGATCTCGTCGTTGCCCGTAACACTCTACTGTGGAAAATTTCGTTAAAAAGTGGTTTCAAATTCTCACTTGTCGCTCAAATTCAGCTCTCATACTGTTTTTGCTTTGCTTGGTTAGTGTATCCTGCGAGCAGCATCACCGATTTGTCAGCAGTTGACACAAGTCTGAAGGCTATGGAACATCAATT...

CDS

Download CDS FASTA

1017 bp · LXL04_010467|LXL04_010467|OH1004|CDS

ATGGATGCCAAGCAAACAGGCTTGTCACTTGATTCTTTAGTGTCATCCTTCAACACTCGCATTGCAGAGCTACAAGATCTCGTCGTTGCCCGTAACACTCTACTGTGGAAAATTTCGTTAAAAAGTGGTTTCAAATTCTCACTTGTCGCTCAAATTCAGCTCTCATACTGTTTTTGCTTTGCTTGGTTAGTGTATCCTGCGAGCAGCATCACCGATTTGTCAGCAGTTGACACAAGTCTGAAGGCTATGGAACATCAATT...

Protein

Download Protein FASTA

338 aa · LXL04_010467|LXL04_010467|OH1004|PROTEIN

MDAKQTGLSLDSLVSSFNTRIAELQDLVVARNTLLWKISLKSGFKFSLVAQIQLSYCFCFAWLVYPASSITDLSAVDTSLKAMEHQLQQIKDCLREETLAIPKAKKLIQASLQQQQKLQSMSVYAPSYMPERGNVTHHDNTTTTCSIIEEPLKHDHSFGSQEPKEEPAPLLRIWNHSAYDNDLMMLLACGLSYYNLTNMDKHIFTYQEKKGRGSPPLWFITANELDSLSSYMRGRLTLDKINAAINDMAVYAQANSQLIT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010467`
TK1151 ID	TkA03G529220
OH-1004 ID	LXL04_010467
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	79.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010467

Location Chr02:147190794-147193408 (-)

Description Similar to At3g60660: Spindle and kinetochore-associated protein 1 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g60660`	SKA complex subunit 1 homolog.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0484500`	SKA complex subunit 1 homolog.	No verified direct reference in this release
`UniProt: B8B624`	SKA complex subunit 1 homolog.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010467 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000070 mitotic sister chromatid segregation Biological Process

GO:0000278 mitotic cell cycle Biological Process

GO:0007059 chromosome segregation Biological Process

GO:0007080 mitotic metaphase chromosome alignment Biological Process

GO:0031110 regulation of microtubule polymerization or depolymerization Biological Process

GO:0051301 cell division Biological Process

GO:0051315 attachment of mitotic spindle microtubules to kinetochore Biological Process

GO:0000940 outer kinetochore Cellular Component

GO:0005876 spindle microtubule Cellular Component

GO:0072686 mitotic spindle Cellular Component

GO:0072687 meiotic spindle Cellular Component

GO:0008017 microtubule binding Molecular Function

KEGG gene cross-reference

ath:AT3G60660

dosa:Os07g0484500

osa:4343243

zma:100193922

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.681

Rank 1 · LXL04_010467 · OH-1004

Cytoplasm0.367

Rank 2 · LXL04_010467 · OH-1004

Mitochondrion0.044

Rank 3 · LXL04_010467 · OH-1004

Cell membrane0.037

Rank 4 · LXL04_010467 · OH-1004

Endoplasmic reticulum0.035

Rank 5 · LXL04_010467 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07160.19SKA162-328 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010467	`PF07160.19`	SKA1	62	328	8e-74	249.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZZ7`	Arabidopsis thaliana	SKA complex subunit 1 homolog	51.327%	Swiss-Prot	strong database homology
`Q7XAM0`	Oryza sativa subsp. japonica	SKA complex subunit 1 homolog	46.567%	Swiss-Prot	moderate database homology
`B8B624`	Oryza sativa subsp. indica	SKA complex subunit 1 homolog	46.567%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card