LXL04_010466 | RubberDandelionOmics

Gene overview

LXL04_010466

Reference: OH-1004 Chr: Chr02 Coordinates: 147190316-147190699 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

384 bp · LXL04_010466|LXL04_010466|OH1004|cDNA

ATGATTTGTTCCAAGGCAACAACTACTCTTTTCATATTACTTAACATAACTATTTTCACATGTGTCCTATCGACCACCAACCCACCAGTCCCACCAACTCCATCTCACCCTAAACCACCCCCACCCAAGTGCCCTAAAGACACCCTAAAGTTTGGCGTTTGTGGTGACTGGCTAGGTCTAGTTCATGAAGTCATTGGGGCTCAACCGGATAGTGAATGCTGTTCATTGATTAAAGGTCTAGCTGACCTTGAAGCAGCGTT...

CDS

Download CDS FASTA

384 bp · LXL04_010466|LXL04_010466|OH1004|CDS

ATGATTTGTTCCAAGGCAACAACTACTCTTTTCATATTACTTAACATAACTATTTTCACATGTGTCCTATCGACCACCAACCCACCAGTCCCACCAACTCCATCTCACCCTAAACCACCCCCACCCAAGTGCCCTAAAGACACCCTAAAGTTTGGCGTTTGTGGTGACTGGCTAGGTCTAGTTCATGAAGTCATTGGGGCTCAACCGGATAGTGAATGCTGTTCATTGATTAAAGGTCTAGCTGACCTTGAAGCAGCGTT...

Protein

Download Protein FASTA

127 aa · LXL04_010466|LXL04_010466|OH1004|PROTEIN

MICSKATTTLFILLNITIFTCVLSTTNPPVPPTPSHPKPPPPKCPKDTLKFGVCGDWLGLVHEVIGAQPDSECCSLIKGLADLEAALCLCTAIKANVLGVLKVKVPVALSLVVNSCGKKVPEGFKCE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010466`
TK1151 ID	TkA03G529230
OH-1004 ID	LXL04_010466
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	86.600
Protein coverage (%)	TK1151 76.970 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010466

Location Chr02:147190316-147190699 (+)

Description Similar to At4g00165: Putative lipid-binding protein At4g00165

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g00165`	Putative lipid-binding protein At4g00165.	No verified direct reference in this release
`At4g12550`	Putative lipid-binding protein AIR1.	No verified direct reference in this release
`At4g12480`	Probable lipid transfer protein (LTP).	Cold responsive EARLI1 type HyPRPs improve freezing survival of yeast cells and form higher order complexes in plants.2007 · DOI: 10.1007/s00425-007-0611-2 The HyPRP gene EARLI1 has an auxiliary role for germinability and early seedling development under low temperature and salt stress conditions in Arabidopsis thaliana.2011 · DOI: 10.1007/s00425-011-1425-9 Influence of EARLI1-like genes on flowering time and lignin synthesis of Arabidopsis thaliana.2011 · DOI: 10.1111/j.1438-8677.2010.00428.x Expression of recombinant EARLI1, a hybrid proline-rich protein of Arabidopsis, in Escherichia coli and its inhibition effect to the growth of fungal pathogens and Saccharomyces cerevisiae.2012 · DOI: 10.1016/j.gene.2012.06.070
`At4g12545`	Putative lipid-binding protein AIR1B.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010466 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009409 response to cold Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009682 induced systemic resistance Biological Process

GO:0009733 response to auxin Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010102 lateral root morphogenesis Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009707 chloroplast outer membrane Cellular Component

KEGG gene cross-reference

ath:AT4G00165

ath:AT4G12480

ath:AT4G12545

ath:AT4G12550

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.462

Rank 1 · LXL04_010466 · OH-1004

Endoplasmic reticulum0.173

Rank 2 · LXL04_010466 · OH-1004

Lysosome / Vacuole0.162

Rank 3 · LXL04_010466 · OH-1004

Cytoplasm0.156

Rank 4 · LXL04_010466 · OH-1004

Cell membrane0.092

Rank 5 · LXL04_010466 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14368.12LTP_241-126 aa

PF14547.12Hydrophob_seed44-126 aa

PF00234.28Tryp_alpha_amyl44-126 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010466	`PF14368.12`	LTP_2	41	126	2.2e-07	31.6
LXL04_010466	`PF14547.12`	Hydrophob_seed	44	126	4.7e-27	94.9
LXL04_010466	`PF00234.28`	Tryp_alpha_amyl	44	126	3.2e-14	53.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RW93`	Arabidopsis thaliana	Putative lipid-binding protein At4g00165	63.158%	Swiss-Prot	strong database homology
`Q9S7I2`	Arabidopsis thaliana	Putative lipid-binding protein AIR1	41.026%	Swiss-Prot	moderate database homology
`Q39176`	Arabidopsis thaliana	Lipid transfer protein EARLI 1	50.588%	Swiss-Prot	moderate database homology
`Q9ZSP6`	Arabidopsis thaliana	Putative lipid-binding protein AIR1B	39.024%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card