LXL04_010352 | RubberDandelionOmics

Gene overview

LXL04_010352

Reference: OH-1004 Chr: Chr02 Coordinates: 144870419-144871921 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

987 bp · LXL04_010352|LXL04_010352|OH1004|cDNA

ATGATCTGCCAAAATCCAGCCATGAAAACCATCGGCCCATGGAGGCCCGGACTTTGTAGACAACTTCAAAAAGCATTTGTTACGGGCGTTCAAAAACTAGATCGCACAGAGCTAGAAACAGCATGTGAGGGTTATAGCAACATAATCGAATCAATGGAAGGTTGTACTTTATACAAAGGAACGTTATCAAGTGGAGTCGAGATTTGTGTTGCTTCAACCACCATTACCAGACTCAAAGACTGGTCAAAGTCAGCAGAGTT...

CDS

Download CDS FASTA

987 bp · LXL04_010352|LXL04_010352|OH1004|CDS

ATGATCTGCCAAAATCCAGCCATGAAAACCATCGGCCCATGGAGGCCCGGACTTTGTAGACAACTTCAAAAAGCATTTGTTACGGGCGTTCAAAAACTAGATCGCACAGAGCTAGAAACAGCATGTGAGGGTTATAGCAACATAATCGAATCAATGGAAGGTTGTACTTTATACAAAGGAACGTTATCAAGTGGAGTCGAGATTTGTGTTGCTTCAACCACCATTACCAGACTCAAAGACTGGTCAAAGTCAGCAGAGTT...

Protein

Download Protein FASTA

328 aa · LXL04_010352|LXL04_010352|OH1004|PROTEIN

MICQNPAMKTIGPWRPGLCRQLQKAFVTGVQKLDRTELETACEGYSNIIESMEGCTLYKGTLSSGVEICVASTTITRLKDWSKSAELTFHNKIEMLSRVNHKNFVNLIGYCKEDKPFCRMMVFEYTPSGSLSDNLHVQGLEHLDWSARMRIILGVAYCLQCMHDLTPPVVPMDLNTKMIYLTNDYAAKVADFSFWKEFSQKAKILGVDRSRRCVVPDKETNIYRFGVVLLEIVSGKLPYSDWAERFLKDDENVSRMIDPT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010352`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010352

Location Chr02:144870419-144871921 (-)

Description Similar to MDIS2: Protein MALE DISCOVERER 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g18640`	Involved in the pollen tube perception of the female signal by binding an unidentified female attractant.	Analysis of the root-hair morphogenesis transcriptome reveals the molecular identity of six genes with roles in root-hair development in Arabidopsis.2006 · DOI: 10.1111/j.1365-313x.2005.02609.x
`At5g45840`	Involved in the pollen tube perception of the female signal.	A receptor heteromer mediates the male perception of female attractants in plants.2016 · DOI: 10.1038/nature16975
`At2g40270`	Inactive receptor-like serine/threonine-protein kinase At2g40270.	No verified direct reference in this release
`At3g56050`	Probable inactive receptor-like protein kinase At3g56050.	No verified direct reference in this release
`At1g63430`	Probable LRR receptor-like serine/threonine-protein kinase At1g63430.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010352 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007166 cell surface receptor signaling pathway Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0048765 root hair cell differentiation Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0090406 pollen tube Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G63430

ath:AT2G40270

ath:AT3G56050

ath:AT4G18640

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.596

Rank 1 · LXL04_010352 · OH-1004

Cytoplasm0.320

Rank 2 · LXL04_010352 · OH-1004

Nucleus0.238

Rank 3 · LXL04_010352 · OH-1004

Endoplasmic reticulum0.029

Rank 4 · LXL04_010352 · OH-1004

Plastid0.024

Rank 5 · LXL04_010352 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714.24PK_Tyr_Ser-Thr75-297 aa

PF00069.32Pkinase84-294 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010352	`PF07714.24`	PK_Tyr_Ser-Thr	75	297	5.2e-22	79.1
LXL04_010352	`PF00069.32`	Pkinase	84	294	1.1e-14	55.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`C0LGQ4`	Arabidopsis thaliana	Protein MALE DISCOVERER 2	54.142%	Swiss-Prot	strong database homology
`C0LGU7`	Arabidopsis thaliana	Protein MALE DISCOVERER 1	54.819%	Swiss-Prot	strong database homology
`Q9SIZ4`	Arabidopsis thaliana	Inactive receptor-like serine/threonine-protein kinase At2g40270	48.308%	Swiss-Prot	moderate database homology
`Q9LYN6`	Arabidopsis thaliana	Probable inactive receptor-like protein kinase At3g56050	45.455%	Swiss-Prot	moderate database homology
`C0LGH8`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase At1g63430	38.679%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card