LXL04_010335 | RubberDandelionOmics

Gene overview

LXL04_010335

Reference: OH-1004 Chr: Chr02 Coordinates: 144453877-144455469 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1593 bp · LXL04_010335|LXL04_010335|OH1004|cDNA

ATGGCTTCTTGCAAGAACTGCAAATCCAAAAACCTAATCGTCGACACCATAACTGGCAATCTAGAATGCTCTCAATGCGGTATAGTCCAAGATTTCGACAACTATGAACAGCAAACCTTCAACGCCACTGGACCAATCGGAACAAACGTCCGATTAGGCACATCCGGATCCCACTACGATTACTCCTACCACGAAACCAAAATCTACCTAGCTCAAAAAGTCGTCTCAGATATCCTCTACAAACTTGACTTAGAAAACCG...

CDS

Download CDS FASTA

1593 bp · LXL04_010335|LXL04_010335|OH1004|CDS

ATGGCTTCTTGCAAGAACTGCAAATCCAAAAACCTAATCGTCGACACCATAACTGGCAATCTAGAATGCTCTCAATGCGGTATAGTCCAAGATTTCGACAACTATGAACAGCAAACCTTCAACGCCACTGGACCAATCGGAACAAACGTCCGATTAGGCACATCCGGATCCCACTACGATTACTCCTACCACGAAACCAAAATCTACCTAGCTCAAAAAGTCGTCTCAGATATCCTCTACAAACTTGACTTAGAAAACCG...

Protein

Download Protein FASTA

530 aa · LXL04_010335|LXL04_010335|OH1004|PROTEIN

MASCKNCKSKNLIVDTITGNLECSQCGIVQDFDNYEQQTFNATGPIGTNVRLGTSGSHYDYSYHETKIYLAQKVVSDILYKLDLENRVDEVTNMIKIITEEEYGSGNWFNVLVGACVYVVMRKANKWLPLTSLCDTIGCDNYELGRMVYRVIDHLDLKLPDFDIVGLYDRVIKELLGCKGNIGKDKISRMVKQGIFLIQCMIKWYVTTGRRPVPVVVAVVVFVCELNDVVDVGFEDLASQLNVVVVTCKLRYKELLKKLV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010335`
TK1151 ID	TkA03G519840
OH-1004 ID	LXL04_010335
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010335

Location Chr02:144453877-144455469 (+)

Description Similar to PTF2: Plant-specific TFIIB-related protein PTF2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g35540`	Plant-specific TFIIB-related protein that plays important roles in pollen germination and embryogenesis, possibly by regulating gene expression through interaction with TBP2 and the subunits of RNA polymerases.	Pollen-expressed transcription factor 2 encodes a novel plant-specific TFIIB-related protein that is required for pollen germination and embryogenesis in Arabidopsis.2013 · DOI: 10.1093/mp/sst083

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010335 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001112 DNA-templated transcription open complex formation Biological Process

GO:0006352 DNA-templated transcription initiation Biological Process

GO:0006359 regulation of transcription by RNA polymerase III Biological Process

GO:0006383 transcription by RNA polymerase III Biological Process

GO:0006384 transcription initiation at RNA polymerase III promoter Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009846 pollen germination Biological Process

GO:0070898 RNA polymerase III preinitiation complex assembly Biological Process

GO:0000126 transcription factor TFIIIB complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0097550 transcription preinitiation complex Cellular Component

KEGG gene cross-reference

ath:AT4G35540

sce:YGR246C

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.956

Rank 1 · LXL04_010335 · OH-1004

Cytoplasm0.107

Rank 2 · LXL04_010335 · OH-1004

Mitochondrion0.019

Rank 3 · LXL04_010335 · OH-1004

Cell membrane0.014

Rank 4 · LXL04_010335 · OH-1004

Endoplasmic reticulum0.006

Rank 5 · LXL04_010335 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08271.18Zn_Ribbon_TF4-35 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010335	`PF08271.18`	Zn_Ribbon_TF	4	35	2.2e-06	27.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81787`	Arabidopsis thaliana	Plant-specific TFIIB-related protein PTF2	41.220%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card