LXL04_010310 | RubberDandelionOmics

Gene overview

LXL04_010310

Reference: OH-1004 Chr: Chr02 Coordinates: 144004913-144005478 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

252 bp · LXL04_010310|LXL04_010310|OH1004|cDNA

ATGGTAGCGCTGATCGGTAACGGCCTCAACGCCGGCTTTCCTAGGCACAACGTTGAAGCTTTTTGGGTTTTGGCGAGAAACTATCTTTATCTTGAAACACATGATTTGTTTGAAAAGATTCGTGAGTTGTTTGAAGAAATCGAGATGACTCCGACGGACGTGGCGGAGAATCTGATGCCGAAGACCAGTCCGGCGGTTACAGAAGGGCGTTTGACGAGCTTGATCgaagttttggagaagatgaaaAAGTGA

CDS

Download CDS FASTA

252 bp · LXL04_010310|LXL04_010310|OH1004|CDS

ATGGTAGCGCTGATCGGTAACGGCCTCAACGCCGGCTTTCCTAGGCACAACGTTGAAGCTTTTTGGGTTTTGGCGAGAAACTATCTTTATCTTGAAACACATGATTTGTTTGAAAAGATTCGTGAGTTGTTTGAAGAAATCGAGATGACTCCGACGGACGTGGCGGAGAATCTGATGCCGAAGACCAGTCCGGCGGTTACAGAAGGGCGTTTGACGAGCTTGATCGAAGTTTTGGAGAAGATGAAAAAGTGA

Protein

Download Protein FASTA

83 aa · LXL04_010310|LXL04_010310|OH1004|PROTEIN

MVALIGNGLNAGFPRHNVEAFWVLARNYLYLETHDLFEKIRELFEEIEMTPTDVAENLMPKTSPAVTEGRLTSLIEVLEKMKK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010310`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010310

Location Chr02:144004913-144005478 (-)

Description Similar to At3g28600: AAA-ATPase At3g28600

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g28600`	AAA-ATPase At3g28600.	No verified direct reference in this release
`At3g28540`	AAA-ATPase At3g28540.	No verified direct reference in this release
`At3g28610`	AAA-ATPase At3g28610.	No verified direct reference in this release
`At3g28510`	AAA-ATPase At3g28510.	No verified direct reference in this release
`At3g28520`	AAA-ATPase At3g28520.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010310 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006950 response to stress Biological Process

GO:0009651 response to salt stress Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

KEGG gene cross-reference

ath:AT3G28510

ath:AT3G28520

ath:AT3G28540

ath:AT3G28600

ath:AT3G28610

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.321

Rank 1 · LXL04_010310 · OH-1004

Cytoplasm0.309

Rank 2 · LXL04_010310 · OH-1004

Mitochondrion0.156

Rank 3 · LXL04_010310 · OH-1004

Plastid0.098

Rank 4 · LXL04_010310 · OH-1004

Extracellular0.090

Rank 5 · LXL04_010310 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25568.1AAA_lid_At3g2854018-83 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010310	`PF25568.1`	AAA_lid_At3g28540	18	83	1.1e-23	83.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4J0C0`	Arabidopsis thaliana	AAA-ATPase At3g28600	52.308%	Swiss-Prot	strong database homology
`Q9LH82`	Arabidopsis thaliana	AAA-ATPase At3g28540	55.172%	Swiss-Prot	moderate database homology
`Q9LJJ5`	Arabidopsis thaliana	AAA-ATPase At3g28610	52.308%	Swiss-Prot	strong database homology
`Q9LH84`	Arabidopsis thaliana	AAA-ATPase At3g28510	47.692%	Swiss-Prot	moderate database homology
`Q9LH83`	Arabidopsis thaliana	AAA-ATPase At3g28520	60.000%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card