LXL04_010282 | RubberDandelionOmics

Gene overview

LXL04_010282

Reference: OH-1004 Chr: Chr02 Coordinates: 143651550-143655072 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

489 bp · LXL04_010282|LXL04_010282|OH1004|cDNA

ATGACTGGCTACCTTGGCAGTAACTTGCTGGAAACATTAATAAGGAATGGTCCTCATATTCCTCCCATGGAACAAAGCCAATGGAGTGAAGATGATAAACAGAAAGTCGCCCTTGAGGCTAAGGCCAAGTATGCTCTGACTGTGTCCCTTCCTGATGACATTTACAGTTTTGTGATGCACTGTGAGTCCGCTAAAGAAATGTGGGACAATCTGATTCTCCTATTTGAAGGTACTGATGAAACAAGGGAGTGTCGTAGCTT...

CDS

Download CDS FASTA

489 bp · LXL04_010282|LXL04_010282|OH1004|CDS

ATGACTGGCTACCTTGGCAGTAACTTGCTGGAAACATTAATAAGGAATGGTCCTCATATTCCTCCCATGGAACAAAGCCAATGGAGTGAAGATGATAAACAGAAAGTCGCCCTTGAGGCTAAGGCCAAGTATGCTCTGACTGTGTCCCTTCCTGATGACATTTACAGTTTTGTGATGCACTGTGAGTCCGCTAAAGAAATGTGGGACAATCTGATTCTCCTATTTGAAGGTACTGATGAAACAAGGGAGTGTCGTAGCTT...

Protein

Download Protein FASTA

162 aa · LXL04_010282|LXL04_010282|OH1004|PROTEIN

MTGYLGSNLLETLIRNGPHIPPMEQSQWSEDDKQKVALEAKAKYALTVSLPDDIYSFVMHCESAKEMWDNLILLFEGTDETRECRSFLDWVFGPTTTTRHVYDIAAQHVVSGAMEGVNGTIFAYGVTSSGKTHTMHTPDHEFLLRVSYLEIYNEVILGIFVF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010282`
TK1151 ID	TkA03G516880
OH-1004 ID	LXL04_010282
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 72.727 / OH-1004 54.321 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010282

Location Chr02:143651550-143655072 (+)

Description Similar to KIN7E: Kinesin-like protein KIN-7E, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g21730`	Kinesin-like protein KIN-7C, mitochondrial.	No verified direct reference in this release
`At3g12020`	Kinesin-like protein KIN-7K, chloroplastic.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0434600`	Kinesin-like protein KIN-7E, chloroplastic.	No verified direct reference in this release
`Os02g0775400`	Probable minus end-directed motor protein with a microtubule-enhanced ATPase activity.	No verified direct reference in this release
`Os06g0206700`	Kinesin-like protein KIN-7G.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010282 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007018 microtubule-based movement Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005871 kinesin complex Cellular Component

GO:0005874 microtubule Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0003777 microtubule motor activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0008017 microtubule binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT1G21730

ath:AT3G12020

osa:9271714

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.579

Rank 1 · LXL04_010282 · OH-1004

Nucleus0.272

Rank 2 · LXL04_010282 · OH-1004

Extracellular0.110

Rank 3 · LXL04_010282 · OH-1004

Mitochondrion0.064

Rank 4 · LXL04_010282 · OH-1004

Endoplasmic reticulum0.060

Rank 5 · LXL04_010282 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14223.15Retrotran_gag_227-83 aa

PF00225.30Kinesin82-138 aa

PF16796.12Microtub_bd84-142 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010282	`PF14223.15`	Retrotran_gag_2	27	83	5.9e-08	33.4
LXL04_010282	`PF00225.30`	Kinesin	82	138	5.4e-18	65.8
LXL04_010282	`PF16796.12`	Microtub_bd	84	142	5.2e-08	33.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W5R6`	Arabidopsis thaliana	Kinesin-like protein KIN-7C, mitochondrial	64.211%	Swiss-Prot	weak database homology
`F4J8L3`	Arabidopsis thaliana	Kinesin-like protein KIN-7K, chloroplastic	64.444%	Swiss-Prot	weak database homology
`B9FFA3`	Oryza sativa subsp. japonica	Kinesin-like protein KIN-7E, chloroplastic	68.132%	Swiss-Prot	weak database homology
`Q6YZ52`	Oryza sativa subsp. japonica	Kinesin-like protein KIN-7D, chloroplastic	67.778%	Swiss-Prot	weak database homology
`B9FS33`	Oryza sativa subsp. japonica	Kinesin-like protein KIN-7G	63.333%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card