LXL04_010248 | RubberDandelionOmics

Gene overview

LXL04_010248

Reference: OH-1004 Chr: Chr02 Coordinates: 142927359-142927749 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

309 bp · LXL04_010248|LXL04_010248|OH1004|cDNA

ATGGAAAATGCTCGATCAAATCCCTTTCTTGATGGTTACAAAGCTCTCTTACAGGAGCCGTTGCCGGAGGCCAAAGATGATATCAATTCTGCTTATTCTTTTTCTGTAGAAGCTGCCTGCATAAATCGAAACTTCTCACAGCAGTTGTTGGGTACAAACCTAAGCAGTTTTCTGGTCAGGTTTAATTTGAATACTTCAAATATGTGGGGAATAGTGAAGGCAATTGTGGATTTGTGCATGAAGTTGAATGAAGGAATCTA...

CDS

Download CDS FASTA

309 bp · LXL04_010248|LXL04_010248|OH1004|CDS

ATGGAAAATGCTCGATCAAATCCCTTTCTTGATGGTTACAAAGCTCTCTTACAGGAGCCGTTGCCGGAGGCCAAAGATGATATCAATTCTGCTTATTCTTTTTCTGTAGAAGCTGCCTGCATAAATCGAAACTTCTCACAGCAGTTGTTGGGTACAAACCTAAGCAGTTTTCTGGTCAGGTTTAATTTGAATACTTCAAATATGTGGGGAATAGTGAAGGCAATTGTGGATTTGTGCATGAAGTTGAATGAAGGAATCTA...

Protein

Download Protein FASTA

102 aa · LXL04_010248|LXL04_010248|OH1004|PROTEIN

MENARSNPFLDGYKALLQEPLPEAKDDINSAYSFSVEAACINRNFSQQLLGTNLSSFLVRFNLNTSNMWGIVKAIVDLCMKLNEGIYVCVGERFTEASSEDL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010248`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010248

Location Chr02:142927359-142927749 (+)

Description Similar to TIF3D1: Eukaryotic translation initiation factor 3 subunit D

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g20980`	mRNA cap-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis of a specialized repertoire of mRNAs and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010248 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001732 formation of cytoplasmic translation initiation complex Biological Process

GO:0002191 cap-dependent translational initiation Biological Process

GO:0006413 translational initiation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005852 eukaryotic translation initiation factor 3 complex Cellular Component

GO:0016282 eukaryotic 43S preinitiation complex Cellular Component

GO:0033290 eukaryotic 48S preinitiation complex Cellular Component

GO:0071540 eukaryotic translation initiation factor 3 complex, eIF3e Cellular Component

GO:0071541 eukaryotic translation initiation factor 3 complex, eIF3m Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0003743 translation initiation factor activity Molecular Function

KEGG gene cross-reference

ath:AT4G20980

ssl:SS1G_13938

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.416

Rank 1 · LXL04_010248 · OH-1004

Nucleus0.382

Rank 2 · LXL04_010248 · OH-1004

Mitochondrion0.146

Rank 3 · LXL04_010248 · OH-1004

Cell membrane0.098

Rank 4 · LXL04_010248 · OH-1004

Endoplasmic reticulum0.073

Rank 5 · LXL04_010248 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05091.19eIF-3_zeta19-52 aa

PF05091.19eIF-3_zeta55-90 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010248	`PF05091.19`	eIF-3_zeta	19	52	4.5e-15	56.3
LXL04_010248	`PF05091.19`	eIF-3_zeta	55	90	4.5e-15	56.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P56820`	Arabidopsis thaliana	Eukaryotic translation initiation factor 3 subunit D	63.636%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card