LXL04_010212 | RubberDandelionOmics

Gene overview

LXL04_010212

Reference: OH-1004 Chr: Chr02 Coordinates: 142219888-142222024 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1368 bp · LXL04_010212|LXL04_010212|OH1004|cDNA

ATGATGAAACAAACAGCAATGGAATTCAACACCAGAAGCAAGAAGAAATCTGTTTTCGATTTCATCTCAGTCGTGTTCCTGTTCTTGTTATCATTCAATGGCGCTTCCATTTTCTCCGTCAAGATTCCTTCACTGGATCGCAGTACCGCCAACTCGCCGCCAAAAGTTGGCCAATATTCAAGAAACTTGATCTCATCATCTCCATTGATGCACGCACTAAAAGAAGAAACACCATCTGAACATTCAATTTCAATACCACG...

CDS

Download CDS FASTA

1368 bp · LXL04_010212|LXL04_010212|OH1004|CDS

ATGATGAAACAAACAGCAATGGAATTCAACACCAGAAGCAAGAAGAAATCTGTTTTCGATTTCATCTCAGTCGTGTTCCTGTTCTTGTTATCATTCAATGGCGCTTCCATTTTCTCCGTCAAGATTCCTTCACTGGATCGCAGTACCGCCAACTCGCCGCCAAAAGTTGGCCAATATTCAAGAAACTTGATCTCATCATCTCCATTGATGCACGCACTAAAAGAAGAAACACCATCTGAACATTCAATTTCAATACCACG...

Protein

Download Protein FASTA

455 aa · LXL04_010212|LXL04_010212|OH1004|PROTEIN

MMKQTAMEFNTRSKKKSVFDFISVVFLFLLSFNGASIFSVKIPSLDRSTANSPPKVGQYSRNLISSSPLMHALKEETPSEHSISIPRLKLQANSKETEITGAGAGDPVNFTSVPFFKHPDTQYKNKKLLKMLTAFGYSRGRRGIDFPARVREFFSKRNDSGSCKVRFFMTWIAPVNAFNERTFHSIESIFKTHPNGCLLIVSNSLDSIKGRQILKPFSEKGFRVTAISPDFDYLFKSTMAESWFSRLIRGHVHSGEIPLG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010212`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010212

Location Chr02:142219888-142222024 (-)

Description Similar to At4g19900: Uncharacterized protein At4g19900

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g19900`	Uncharacterized protein At4g19900.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010212 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001576 globoside biosynthetic process Biological Process

GO:0006688 glycosphingolipid biosynthetic process Biological Process

GO:0007009 plasma membrane organization Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0016020 membrane Cellular Component

GO:0008378 galactosyltransferase activity Molecular Function

GO:0015643 toxic substance binding Molecular Function

GO:0050512 lactosylceramide 4-alpha-galactosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT4G19900

hsa:53947

mmu:239559

rno:63888

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.623

Rank 1 · LXL04_010212 · OH-1004

Endoplasmic reticulum0.120

Rank 2 · LXL04_010212 · OH-1004

Cell membrane0.099

Rank 3 · LXL04_010212 · OH-1004

Extracellular0.078

Rank 4 · LXL04_010212 · OH-1004

Cytoplasm0.070

Rank 5 · LXL04_010212 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04488.22Gly_transf_sug181-301 aa

PF04572.18Gb3_synth319-381 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010212	`PF04488.22`	Gly_transf_sug	181	301	4.6e-19	69.6
LXL04_010212	`PF04572.18`	Gb3_synth	319	381	4.9e-11	43.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P0C8Q4`	Arabidopsis thaliana	Uncharacterized protein At4g19900	30.651%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card