LXL04_010164 | RubberDandelionOmics

Gene overview

LXL04_010164

Reference: OH-1004 Chr: Chr02 Coordinates: 141281551-141284023 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

462 bp · LXL04_010164|LXL04_010164|OH1004|cDNA

ATGGCGACGGAGATCGCGAGGGTAGTTGACTACGCGGAATACGTGTGCGCAGTGGAGCATAAAGGGCTTGCGATGAAGTTGCCATACGATTTTGCATACGGAAATTTGATGGTGCCTCGCCGGAGTGGTCGCCGGAAATGGGAAACGAGAGAAAACAGGAACGAAGGTGCTTTCGGGTTTGGTTGGTTCTTCCCATTTTACTTGTTACACATAGGCTTTGTAACCTTTGCTGCTGTTTCTCCTCCCATTGTCTTCAATGG...

CDS

Download CDS FASTA

462 bp · LXL04_010164|LXL04_010164|OH1004|CDS

ATGGCGACGGAGATCGCGAGGGTAGTTGACTACGCGGAATACGTGTGCGCAGTGGAGCATAAAGGGCTTGCGATGAAGTTGCCATACGATTTTGCATACGGAAATTTGATGGTGCCTCGCCGGAGTGGTCGCCGGAAATGGGAAACGAGAGAAAACAGGAACGAAGGTGCTTTCGGGTTTGGTTGGTTCTTCCCATTTTACTTGTTACACATAGGCTTTGTAACCTTTGCTGCTGTTTCTCCTCCCATTGTCTTCAATGG...

Protein

Download Protein FASTA

153 aa · LXL04_010164|LXL04_010164|OH1004|PROTEIN

MATEIARVVDYAEYVCAVEHKGLAMKLPYDFAYGNLMVPRRSGRRKWETRENRNEGAFGFGWFFPFYLLHIGFVTFAAVSPPIVFNGKSITGILPAVDLIGVEALVGFFYFIGFGLFCVEWLLSIWAIQQIHINFPKSRRAVEMTSRGAWGAI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010164`
TK1151 ID	TkA03G508460
OH-1004 ID	LXL04_010164
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.000
Protein coverage (%)	TK1151 99.020 / OH-1004 66.013 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010164

Location Chr02:141281551-141284023 (-)

Description Similar to SCAMP5: Secretory carrier-associated membrane protein 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g11180`	Probably involved in membrane trafficking.	No verified direct reference in this release
`At1g61250`	Probably involved in membrane trafficking.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2YMP7`	Probably involved in membrane trafficking.	No verified direct reference in this release
`Os07g0564600`	Probably involved in membrane trafficking.	No verified direct reference in this release
`Os05g0503000`	Probably involved in membrane trafficking.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010164 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0015031 protein transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005768 endosome Cellular Component

GO:0005769 early endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0030658 transport vesicle membrane Cellular Component

GO:0032588 trans-Golgi network membrane Cellular Component

GO:0055038 recycling endosome membrane Cellular Component

KEGG gene cross-reference

ath:AT1G11180

ath:AT1G61250

dosa:Os05g0503000

dosa:Os07g0564600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.264

Rank 1 · LXL04_010164 · OH-1004

Golgi apparatus0.256

Rank 2 · LXL04_010164 · OH-1004

Cell membrane0.249

Rank 3 · LXL04_010164 · OH-1004

Lysosome / Vacuole0.188

Rank 4 · LXL04_010164 · OH-1004

Cytoplasm0.183

Rank 5 · LXL04_010164 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04144.19SCAMP53-133 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010164	`PF04144.19`	SCAMP	53	133	4.1e-13	50.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SXA5`	Arabidopsis thaliana	Secretory carrier-associated membrane protein 5	58.654%	Swiss-Prot	moderate database homology
`Q9M5P2`	Arabidopsis thaliana	Secretory carrier-associated membrane protein 3	52.885%	Swiss-Prot	moderate database homology
`A2YMP7`	Oryza sativa subsp. indica	Putative secretory carrier-associated membrane protein 1	58.416%	Swiss-Prot	moderate database homology
`Q8H5X5`	Oryza sativa subsp. japonica	Secretory carrier-associated membrane protein 1	58.416%	Swiss-Prot	moderate database homology
`Q60EA5`	Oryza sativa subsp. japonica	Secretory carrier-associated membrane protein 3	58.416%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card