LXL04_010160 | RubberDandelionOmics

Gene overview

LXL04_010160

Reference: OH-1004 Chr: Chr02 Coordinates: 141261627-141263815 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1539 bp · LXL04_010160|LXL04_010160|OH1004|cDNA

ATGGCGCTTGCAAGAATTTCAAGGAACTGGAGACGATCATCAGGAACAATGGCCATTATTCCATCATACCTACAAACCTTAACAAACACCAATCATACGAATTTCATGAACAGGGGAAAACAGGGGATTATTCAAGGATACAGATTCGGTCATGCGGAGAGGCTTTCAGAAACTGAATTTCACTATGCTAGTCTTGAACCAACTAAACCAGGGGACAAACCTAGGGTTGTGGTCCTTGGTACTGGTTGGGCTGCATGTAG...

CDS

Download CDS FASTA

1539 bp · LXL04_010160|LXL04_010160|OH1004|CDS

ATGGCGCTTGCAAGAATTTCAAGGAACTGGAGACGATCATCAGGAACAATGGCCATTATTCCATCATACCTACAAACCTTAACAAACACCAATCATACGAATTTCATGAACAGGGGAAAACAGGGGATTATTCAAGGATACAGATTCGGTCATGCGGAGAGGCTTTCAGAAACTGAATTTCACTATGCTAGTCTTGAACCAACTAAACCAGGGGACAAACCTAGGGTTGTGGTCCTTGGTACTGGTTGGGCTGCATGTAG...

Protein

Download Protein FASTA

512 aa · LXL04_010160|LXL04_010160|OH1004|PROTEIN

MALARISRNWRRSSGTMAIIPSYLQTLTNTNHTNFMNRGKQGIIQGYRFGHAERLSETEFHYASLEPTKPGDKPRVVVLGTGWAACRFLKGLDTSMYDIVCISPRNHMVFTPLLASTCVGTLELRSVTEPVGRVQPALAKHPNSYFYLASCTNIDTKKHEVYCETDDGNLGVSDEPYRFKVAYDKLVIASGAEPLTFGIKGVKEHAHFLREVSHAQEIRKKLLLNLIVSETPGVSEEEKERLLHCVVIGGGPTGVEFSGE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010160`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010160

Location Chr02:141261627-141263815 (+)

Description Similar to NDA2: Internal alternative NAD(P)H-ubiquinone oxidoreductase A2, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g29990`	Alternative NADH-ubiquinone oxidoreductase which catalyzes the oxidation of mitochondrial NADH does not translocate protons across the inner mitochondrial membrane.	No verified direct reference in this release
`At1g07180`	Alternative NADH-ubiquinone oxidoreductase which catalyzes the oxidation of mitochondrial NADH does not translocate protons across the inner mitochondrial membrane.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010160 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0071482 cellular response to light stimulus Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0003954 NADH dehydrogenase activity Molecular Function

GO:0003959 NADPH dehydrogenase activity Molecular Function

GO:0008137 NADH dehydrogenase (ubiquinone) activity Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0120555 NADH dehydrogenase (ubiquinone) (non-electrogenic) activity Molecular Function

KEGG gene cross-reference

ath:AT1G07180

ath:AT2G29990

ddi:DDB_G0270104

sot:102598594

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.950

Rank 1 · LXL04_010160 · OH-1004

Cytoplasm0.064

Rank 2 · LXL04_010160 · OH-1004

Nucleus0.052

Rank 3 · LXL04_010160 · OH-1004

Cell membrane0.037

Rank 4 · LXL04_010160 · OH-1004

Endoplasmic reticulum0.015

Rank 5 · LXL04_010160 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07992.21Pyr_redox_275-407 aa

PF00070.34Pyr_redox244-316 aa

PF22366.2NDH2_C442-508 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010160	`PF07992.21`	Pyr_redox_2	75	407	2.5e-52	178.8
LXL04_010160	`PF00070.34`	Pyr_redox	244	316	8.4e-08	33.3
LXL04_010160	`PF22366.2`	NDH2_C	442	508	2.7e-15	57.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80874`	Arabidopsis thaliana	Internal alternative NAD(P)H-ubiquinone oxidoreductase A2, mitochondrial	71.239%	Swiss-Prot	strong database homology
`Q8GWA1`	Arabidopsis thaliana	Internal alternative NAD(P)H-ubiquinone oxidoreductase A1, mitochondrial	69.757%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card