RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_010084
Reference: OH-1004 Chr: Chr02 Coordinates: 139623499-139625250 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1752 bp · LXL04_010084|LXL04_010084|OH1004|cDNA

ATGCAGAACAGCAAGCTCTTGATCAAAGCACTCTCCAGTAACACAACAAAGACCACCCAAAACTGGAGATCCCAAATAAATCAATCCAATTTAATTTCTCAAATCTCATCTATCCTTTTACAAAGACACAATTGGCCTTCACTTCTCCAAACCCTAAATCTCAAATCGAAATTGACCCCACCACTCTTCCTTCAAATCCTCAACACAACAAAAACCCAACCTCAAATCTCCCTTGATTTCTTCAAATGGGCGATCAAGAA...

CDS

Download CDS FASTA

1752 bp · LXL04_010084|LXL04_010084|OH1004|CDS

ATGCAGAACAGCAAGCTCTTGATCAAAGCACTCTCCAGTAACACAACAAAGACCACCCAAAACTGGAGATCCCAAATAAATCAATCCAATTTAATTTCTCAAATCTCATCTATCCTTTTACAAAGACACAATTGGCCTTCACTTCTCCAAACCCTAAATCTCAAATCGAAATTGACCCCACCACTCTTCCTTCAAATCCTCAACACAACAAAAACCCAACCTCAAATCTCCCTTGATTTCTTCAAATGGGCGATCAAGAA...

Protein

Download Protein FASTA

583 aa · LXL04_010084|LXL04_010084|OH1004|PROTEIN

MQNSKLLIKALSSNTTKTTQNWRSQINQSNLISQISSILLQRHNWPSLLQTLNLKSKLTPPLFLQILNTTKTQPQISLDFFKWAIKNAAFQPDLTVQCRMAHLLIVSGLVNPSKPILNSLLENNPPAQIAQSLIMSCTKYGDFCSSESLVVFDCVLGWYCEKGLCFQALEVFNLTRDLTKTNCSNPSEMFSVLSYNTLLNALQENNEVKLGLCFYAVMIRHGVLIDGFTWRILAKIFGKQGKVDAMLRIIKMGVHDPLIY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_010084
TK1151 IDTkA03G496160
OH-1004 IDLXL04_010084
Relationship / confidenceRbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)99.700
Protein coverage (%)TK1151 100.000 / OH-1004 62.779
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_010084
LocationChr02:139623499-139625250 (-)
DescriptionSimilar to At4g21170: Pentatricopeptide repeat-containing protein At4g21170
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g21170 Pentatricopeptide repeat-containing protein At4g21170. No verified direct reference in this release
At5g01110 Pentatricopeptide repeat-containing protein At5g01110. No verified direct reference in this release
At2g32630 Pentatricopeptide repeat-containing protein At2g32630. No verified direct reference in this release
At5g61990 Pentatricopeptide repeat-containing protein At5g61990, mitochondrial. No verified direct reference in this release
At2g15630 Pentatricopeptide repeat-containing protein At2g15630, mitochondrial. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_010084 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0006396 RNA processing Biological Process
GO:0007005 mitochondrion organization Biological Process
GO:0005739 mitochondrion Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0009536 plastid Cellular Component
GO:0003729 mRNA binding Molecular Function
KEGG gene cross-reference
ath:AT2G32630
ath:AT4G21170
ath:AT5G01110
ath:AT5G61990
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.829
Rank 1 · LXL04_010084 · OH-1004
Plastid0.068
Rank 2 · LXL04_010084 · OH-1004
Nucleus0.058
Rank 3 · LXL04_010084 · OH-1004
Cytoplasm0.030
Rank 4 · LXL04_010084 · OH-1004
Cell membrane0.009
Rank 5 · LXL04_010084 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13041.13PPR_2192-235 aa
PF13041.13PPR_2259-304 aa
PF13041.13PPR_2473-514 aa
PF13812.13PPR_3492-532 aa
PF12854.14PPR_1497-530 aa
PF13041.13PPR_2502-549 aa
PF01535.27PPR539-568 aa
PF13041.13PPR_2540-575 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_010084PF13041.13PPR_21922351.2e-39134.9
LXL04_010084PF13041.13PPR_22593041.2e-39134.9
LXL04_010084PF13041.13PPR_24735141.2e-39134.9
LXL04_010084PF13812.13PPR_34925321.6e-1144.9
LXL04_010084PF12854.14PPR_14975304.6e-1555.8
LXL04_010084PF13041.13PPR_25025491.2e-39134.9
LXL04_010084PF01535.27PPR5395685.1e-2483.5
LXL04_010084PF13041.13PPR_25405751.2e-39134.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
O49558Arabidopsis thalianaPentatricopeptide repeat-containing protein At4g2117034.615%Swiss-Protmoderate database homology
Q9LFC5Arabidopsis thalianaPentatricopeptide repeat-containing protein At5g0111023.265%Swiss-Protweak database homology
Q8S8P6Arabidopsis thalianaPentatricopeptide repeat-containing protein At2g3263022.570%Swiss-Protweak database homology
Q9FIT7Arabidopsis thalianaPentatricopeptide repeat-containing protein At5g61990, mitochondrial24.181%Swiss-Protweak database homology
Q9ZQF1Arabidopsis thalianaPentatricopeptide repeat-containing protein At2g15630, mitochondrial22.527%Swiss-Protweak database homology

JBrowse

View in Genome Browser