LXL04_010062 | RubberDandelionOmics

Gene overview

LXL04_010062

Reference: OH-1004 Chr: Chr02 Coordinates: 139257230-139259411 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1623 bp · LXL04_010062|LXL04_010062|OH1004|cDNA

TATAAATAATAGTGCAGATAATGTAATCAAGAGCAGCATTTGCACCACCACTCACGAGACTCAAAAACGGGCTCGCCGTAGCCAATGGATCCAAGGTCCACCCACGATGGTCAGCTGACCCAACCCATTCTCTCCGACCACCGGGTGGCTCCAGAGTCGCCGCGGGGGGAGGTGGTGAGTTCGGAGCTGGAGGAGATCCTATGCGACACCACTTTAACTCCCTTCCGGCGATACCGGAAGGCATTGTCCCTCGAACTGGT...

CDS

Download CDS FASTA

1539 bp · LXL04_010062|LXL04_010062|OH1004|CDS

ATGGATCCAAGGTCCACCCACGATGGTCAGCTGACCCAACCCATTCTCTCCGACCACCGGGTGGCTCCAGAGTCGCCGCGGGGGGAGGTGGTGAGTTCGGAGCTGGAGGAGATCCTATGCGACACCACTTTAACTCCCTTCCGGCGATACCGGAAGGCATTGTCCCTCGAACTGGTTAGCATGTTCCGGCTAGCAGGTCCGACGGTCATAGTCTACTTGCTGAACAACGTCACGTCGGTATCCACCCAAATCTTCTGCGG...

Protein

Download Protein FASTA

512 aa · LXL04_010062|LXL04_010062|OH1004|PROTEIN

MDPRSTHDGQLTQPILSDHRVAPESPRGEVVSSELEEILCDTTLTPFRRYRKALSLELVSMFRLAGPTVIVYLLNNVTSVSTQIFCGHLGNLQLAAATLGNNGVQIFAFGLLLGMGSAVETLCGQAFGARQFEMLGVYLQRSTILLMLTAIPLMLIYIFSKPLLILIGQSREISAAASLFIFGLIPQIFAYAANFPIQKFLQAQSIVNPSAYIAAGMLLVHIPLTYLVMYVWDWGLLGGALVLSLSWWLIVIFQFVYILK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010062`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010062

Location Chr02:139257230-139259411 (-)

Description Similar to DTX40: Protein DETOXIFICATION 40

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g21690`	Protein DETOXIFICATION 40.	No verified direct reference in this release
`At1g11670`	Protein DETOXIFICATION 36.	No verified direct reference in this release
`At1g61890`	Protein DETOXIFICATION 37.	No verified direct reference in this release
`At4g21910`	Protein DETOXIFICATION 39.	No verified direct reference in this release
`At4g21903`	Protein DETOXIFICATION 38.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010062 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:1990961 xenobiotic detoxification by transmembrane export across the plasma membrane Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0015297 antiporter activity Molecular Function

GO:0022857 transmembrane transporter activity Molecular Function

GO:0042910 xenobiotic transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G11670

ath:AT1G61890

ath:AT3G21690

ath:AT4G21903

ath:AT4G21910

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.388

Rank 1 · LXL04_010062 · OH-1004

Cell membrane0.370

Rank 2 · LXL04_010062 · OH-1004

Endoplasmic reticulum0.105

Rank 3 · LXL04_010062 · OH-1004

Cytoplasm0.088

Rank 4 · LXL04_010062 · OH-1004

Golgi apparatus0.085

Rank 5 · LXL04_010062 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01554.24MatE67-227 aa

PF01554.24MatE289-450 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010062	`PF01554.24`	MatE	67	227	4e-65	219.1
LXL04_010062	`PF01554.24`	MatE	289	450	4e-65	219.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LVD9`	Arabidopsis thaliana	Protein DETOXIFICATION 40	63.458%	Swiss-Prot	strong database homology
`Q9SAB0`	Arabidopsis thaliana	Protein DETOXIFICATION 36	57.086%	Swiss-Prot	strong database homology
`O80695`	Arabidopsis thaliana	Protein DETOXIFICATION 37	57.637%	Swiss-Prot	strong database homology
`Q940N9`	Arabidopsis thaliana	Protein DETOXIFICATION 39	53.877%	Swiss-Prot	strong database homology
`F4JKB9`	Arabidopsis thaliana	Protein DETOXIFICATION 38	52.823%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card