LXL04_009987 | RubberDandelionOmics

Gene overview

LXL04_009987

Reference: OH-1004 Chr: Chr02 Coordinates: 137334844-137344462 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4989 bp · LXL04_009987|LXL04_009987|OH1004|cDNA

ATGGCGACGCTAGCAGATATCGGTCTGTCGGCAGCCATTAATATCATCACTGCTTTTATTTTCCTGATAGCTTTCGCTATCCTTCGACTTCAACCTTTCAACGATCGAGTATACTTTCCAAAATGGTATCTCAAGGGTTTACGATCAAGCCCTGCAACTTCCGGTGCTTTTGTAAGCAAGTTCATCAATCTGGATTATCGATCCTATTTAAAATTCCTTAATTGGATGCCGGATGCCCTAAAAATGCCCGAGCCTGAGCT...

CDS

Download CDS FASTA

4989 bp · LXL04_009987|LXL04_009987|OH1004|CDS

ATGGCGACGCTAGCAGATATCGGTCTGTCGGCAGCCATTAATATCATCACTGCTTTTATTTTCCTGATAGCTTTCGCTATCCTTCGACTTCAACCTTTCAACGATCGAGTATACTTTCCAAAATGGTATCTCAAGGGTTTACGATCAAGCCCTGCAACTTCCGGTGCTTTTGTAAGCAAGTTCATCAATCTGGATTATCGATCCTATTTAAAATTCCTTAATTGGATGCCGGATGCCCTAAAAATGCCCGAGCCTGAGCT...

Protein

Download Protein FASTA

1662 aa · LXL04_009987|LXL04_009987|OH1004|PROTEIN

MATLADIGLSAAINIITAFIFLIAFAILRLQPFNDRVYFPKWYLKGLRSSPATSGAFVSKFINLDYRSYLKFLNWMPDALKMPEPELIDHAGLDSAVYLRIYLLGLKIFIPILVLTWAILVPVNWTNDTLDKLKGEATYIMAYVVTFWTCFALKREYETIANMRLHFLQSEKRRPDQFTVLVNNVPPDADESVSEAVEHFFLVNHPDNYLTHQVVLNANKLAKLVGEKKTKQNWLVYYQNKYERNQEKRPVMKTGFLGLW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009987`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009987

Location Chr02:137334844-137344462 (-)

Description Similar to EMB2369: Leucine--tRNA ligase, chloroplastic/mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g04350`	Catalyzes the specific attachment of an amino acid to its cognate tRNA in a two step reaction: the amino acid (AA) is first activated by ATP to form AA-AMP and then transferred to the acceptor end of the tRNA.	No verified direct reference in this release
`At4g22120`	Acts as an osmosensitive calcium-permeable cation channel.	OSCA/TMEM63 are an Evolutionarily Conserved Family of Mechanically Activated Ion Channels.2018 · DOI: 10.7554/elife.41844 Structure-guided mutagenesis of OSCAs reveals differential activation to mechanical stimuli.2024 · DOI: 10.7554/elife.93147
`At4g04340`	May act as a hyperosmolarity-gated nonselective cation channel permeable to Ca²⁺.	OSCA1 mediates osmotic-stress-evoked Ca2+ increases vital for osmosensing in Arabidopsis.2014 · DOI: 10.1038/nature13593 OSCA/TMEM63 are an Evolutionarily Conserved Family of Mechanically Activated Ion Channels.2018 · DOI: 10.7554/elife.41844
`At3g21620`	Acts as an osmosensitive calcium-permeable cation channel.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009987 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006429 leucyl-tRNA aminoacylation Biological Process

GO:0006812 monoatomic cation transport Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0051262 protein tetramerization Biological Process

GO:0071474 cellular hyperosmotic response Biological Process

GO:0090279 regulation of calcium ion import Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

KEGG gene cross-reference

ath:AT3G21620

ath:AT4G04340

ath:AT4G04350

ath:AT4G22120

sru:SRU_0933

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.452

Rank 1 · LXL04_009987 · OH-1004

Plastid0.138

Rank 2 · LXL04_009987 · OH-1004

Cell membrane0.135

Rank 3 · LXL04_009987 · OH-1004

Cytoplasm0.096

Rank 4 · LXL04_009987 · OH-1004

Mitochondrion0.092

Rank 5 · LXL04_009987 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13967.12RSN1_TM8-147 aa

PF14703.13PHM7_cyt177-339 aa

PF02714.21RSN1_7TM350-622 aa

PF00133.29tRNA-synt_1781-998 aa

PF09334.18tRNA-synt_1g811-943 aa

PF13603.13tRNA-synt_1_2993-1185 aa

PF00133.29tRNA-synt_11180-1361 aa

PF00133.29tRNA-synt_11417-1447 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009987	`PF13967.12`	RSN1_TM	8	147	3e-26	92.7
LXL04_009987	`PF14703.13`	PHM7_cyt	177	339	8.2e-44	150.6
LXL04_009987	`PF02714.21`	RSN1_7TM	350	622	1.2e-86	291.3
LXL04_009987	`PF00133.29`	tRNA-synt_1	781	998	4.8e-45	154.8
LXL04_009987	`PF09334.18`	tRNA-synt_1g	811	943	2.9e-24	86.3
LXL04_009987	`PF13603.13`	tRNA-synt_1_2	993	1185	3.6e-59	200.1
LXL04_009987	`PF00133.29`	tRNA-synt_1	1180	1361	4.8e-45	154.8
LXL04_009987	`PF00133.29`	tRNA-synt_1	1417	1447	4.8e-45	154.8
LXL04_009987	`PF08264.20`	Anticodon_1	1503	1609	1.1e-15	58.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XEA0`	Arabidopsis thaliana	Leucine--tRNA ligase, chloroplastic/mitochondrial	76.269%	Swiss-Prot	moderate database homology
`Q5XEZ5`	Arabidopsis thaliana	Hyperosmolality-gated Ca2+ permeable channel 1.2	73.719%	Swiss-Prot	weak database homology
`Q9XEA1`	Arabidopsis thaliana	Hyperosmolality-gated Ca2+ permeable channel 1.1	73.203%	Swiss-Prot	weak database homology
`Q9LVE4`	Arabidopsis thaliana	Hyperosmolality-gated Ca2+ permeable channel 1.5	70.628%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card