LXL04_009977 | RubberDandelionOmics

Gene overview

LXL04_009977

Reference: OH-1004 Chr: Chr02 Coordinates: 137150482-137152391 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1446 bp · LXL04_009977|LXL04_009977|OH1004|cDNA

ATGGTTTCTCTTCAAGAATCCCCCAATTCCACTCCGGGTCGGTTTCAGATTACCCGACCCTATTACACTCCACCTCCATCTTCCGCTGCTTCTTCCCCATCCAGGTTCCAGAAGCATCTAGGTCGATCCATGCGAACTGTGCGCTCCAATTTCTACCAGTCCGAATACACCGACAGTTGCTCTTTCGTTTCCACTCAACAGGCTGCACCGTCCGTTGTATCGGAAAACCTTACGGACTCCGTCATCGATGTTCATTTACA...

CDS

Download CDS FASTA

1446 bp · LXL04_009977|LXL04_009977|OH1004|CDS

ATGGTTTCTCTTCAAGAATCCCCCAATTCCACTCCGGGTCGGTTTCAGATTACCCGACCCTATTACACTCCACCTCCATCTTCCGCTGCTTCTTCCCCATCCAGGTTCCAGAAGCATCTAGGTCGATCCATGCGAACTGTGCGCTCCAATTTCTACCAGTCCGAATACACCGACAGTTGCTCTTTCGTTTCCACTCAACAGGCTGCACCGTCCGTTGTATCGGAAAACCTTACGGACTCCGTCATCGATGTTCATTTACA...

Protein

Download Protein FASTA

481 aa · LXL04_009977|LXL04_009977|OH1004|PROTEIN

MVSLQESPNSTPGRFQITRPYYTPPPSSAASSPSRFQKHLGRSMRTVRSNFYQSEYTDSCSFVSTQQAAPSVVSENLTDSVIDVHLHQLATATGNNKFSKSSSETSSEDFPGFSQVFSDFSAYSSDISGELQRLACLPEDLNENDFNQEQGPEPEPCLGFLQREHFSTEIIESISPEDLQPTVKICVDSLGSNSVALKRSAAAKLRMLAKNRSENRALIGESGAVPALIPLLRCADPWTQEHAVTALLNLSLLDENKPLI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009977`
TK1151 ID	TkA03G487330
OH-1004 ID	LXL04_009977
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009977

Location Chr02:137150482-137152391 (-)

Description Similar to PUB4: U-box domain-containing protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g23140`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release
`At5g67340`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release
`At3g54790`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release
`At1g71020`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release
`At1g23030`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009977 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016567 protein ubiquitination Biological Process

GO:0031648 protein destabilization Biological Process

GO:0034614 cellular response to reactive oxygen species Biological Process

GO:0048364 root development Biological Process

GO:0048658 anther wall tapetum development Biological Process

GO:0051865 protein autoubiquitination Biological Process

GO:0090333 regulation of stomatal closure Biological Process

GO:1904821 chloroplast disassembly Biological Process

GO:2000022 regulation of jasmonic acid mediated signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0004842 ubiquitin-protein transferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G23030

ath:AT1G71020

ath:AT2G23140

ath:AT3G54790

ath:AT5G67340

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.553

Rank 1 · LXL04_009977 · OH-1004

Nucleus0.373

Rank 2 · LXL04_009977 · OH-1004

Cell membrane0.177

Rank 3 · LXL04_009977 · OH-1004

Endoplasmic reticulum0.052

Rank 4 · LXL04_009977 · OH-1004

Golgi apparatus0.050

Rank 5 · LXL04_009977 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24768.2ARM_ARMC5183-321 aa

PF25598.2ARM_PUB200-467 aa

PF00514.30Arm213-251 aa

PF24768.2ARM_ARMC5246-453 aa

PF00514.30Arm295-334 aa

PF25571.2TPR_CCP1_N297-411 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009977	`PF24768.2`	ARM_ARMC5	183	321	5.3e-19	69.4
LXL04_009977	`PF25598.2`	ARM_PUB	200	467	6.7e-22	79.0
LXL04_009977	`PF00514.30`	Arm	213	251	2.5e-30	104.2
LXL04_009977	`PF24768.2`	ARM_ARMC5	246	453	5.3e-19	69.4
LXL04_009977	`PF00514.30`	Arm	295	334	2.5e-30	104.2
LXL04_009977	`PF25571.2`	TPR_CCP1_N	297	411	2e-06	27.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22193`	Arabidopsis thaliana	U-box domain-containing protein 4	42.500%	Swiss-Prot	moderate database homology
`Q5XEZ8`	Arabidopsis thaliana	U-box domain-containing protein 2	48.013%	Swiss-Prot	moderate database homology
`Q8GWV5`	Arabidopsis thaliana	U-box domain-containing protein 3	46.735%	Swiss-Prot	moderate database homology
`Q9C9A6`	Arabidopsis thaliana	U-box domain-containing protein 10	42.230%	Swiss-Prot	moderate database homology
`Q8GUG9`	Arabidopsis thaliana	U-box domain-containing protein 11	41.237%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card