LXL04_009943 | RubberDandelionOmics

Gene overview

LXL04_009943

Reference: OH-1004 Chr: Chr02 Coordinates: 136486647-136488935 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1602 bp · LXL04_009943|LXL04_009943|OH1004|cDNA

ATGATGATGATGATCCAATCGGGTGTAGGAGGAGGAGTAACGAGTAACAAGGCCGCCACCAGTACCACCCGACTTGCTTCTTTCAGTGCTTCTCAGATCTTCGGCGGCTGCCATGAGCGGGATATTCTTCTGAAGAAAACCAAATCCTCTGTTCCATTCGCGCACCGGAAAACATCTCATTCCAACATTACTGAtggcagaagaagaagaaaaagcaGCAGCACAAGTCCGCATCTTGTTTGCCCCAAAGCTGTTTCTGA...

CDS

Download CDS FASTA

1602 bp · LXL04_009943|LXL04_009943|OH1004|CDS

ATGATGATGATGATCCAATCGGGTGTAGGAGGAGGAGTAACGAGTAACAAGGCCGCCACCAGTACCACCCGACTTGCTTCTTTCAGTGCTTCTCAGATCTTCGGCGGCTGCCATGAGCGGGATATTCTTCTGAAGAAAACCAAATCCTCTGTTCCATTCGCGCACCGGAAAACATCTCATTCCAACATTACTGATGGCAGAAGAAGAAGAAAAAGCAGCAGCACAAGTCCGCATCTTGTTTGCCCCAAAGCTGTTTCTGA...

Protein

Download Protein FASTA

533 aa · LXL04_009943|LXL04_009943|OH1004|PROTEIN

MMMMIQSGVGGGVTSNKAATSTTRLASFSASQIFGGCHERDILLKKTKSSVPFAHRKTSHSNITDGRRRRKSSSTSPHLVCPKAVSDSSYSQTCLDPDASHSVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRAYATNMGGYKNEGFVEVLAAQQSPENPDWFQGTADAVRQYLWLLEEQNVLEYLVLAGDHLYRMDYEKFIQAHRETDADITVAALPMDEKRA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009943`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009943

Location Chr02:136486647-136488935 (-)

Description Similar to AGPS1: Glucose-1-phosphate adenylyltransferase small subunit, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g48300`	This protein plays a role in synthesis of starch.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009943 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005978 glycogen biosynthetic process Biological Process

GO:0019252 starch biosynthetic process Biological Process

GO:0048573 photoperiodism, flowering Biological Process

GO:0009501 amyloplast Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0010170 glucose-1-phosphate adenylyltransferase complex Cellular Component

GO:0030931 heterotetrameric ADPG pyrophosphorylase complex Cellular Component

GO:0048046 apoplast Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0008878 glucose-1-phosphate adenylyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT5G48300

bna:106366674

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.970

Rank 1 · LXL04_009943 · OH-1004

Mitochondrion0.046

Rank 2 · LXL04_009943 · OH-1004

Cytoplasm0.027

Rank 3 · LXL04_009943 · OH-1004

Peroxisome0.021

Rank 4 · LXL04_009943 · OH-1004

Nucleus0.017

Rank 5 · LXL04_009943 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00483.30NTP_transferase105-378 aa

PF25247.2LbH_GLGC398-532 aa

PF24894.2Hexapep_GlmU408-450 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009943	`PF00483.30`	NTP_transferase	105	378	9.2e-67	225.9
LXL04_009943	`PF25247.2`	LbH_GLGC	398	532	1.6e-53	180.9
LXL04_009943	`PF24894.2`	Hexapep_GlmU	408	450	1.3e-09	38.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P55228`	Arabidopsis thaliana	Glucose-1-phosphate adenylyltransferase small subunit, chloroplastic	91.048%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card