LXL04_009930 | RubberDandelionOmics

Gene overview

LXL04_009930

Reference: OH-1004 Chr: Chr02 Coordinates: 136093181-136094789 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1428 bp · LXL04_009930|LXL04_009930|OH1004|cDNA

ATGGTGGTTCTTCGATCCTGCAAGTTTGCTGATCATACTTTATCATCAAATTCGAATCGCATTTCGAGAATTTTCTTCAAAAACTCATTTTCTTCGACCAACGCACAAACCTCTTCAGTTCAGAATCATGATGCTCTATATAAGCGAATCTCACTGTCCGCAATAATGCAAAAGACTTCAGTTGTTCCGATAATCGAGCAATGGGTCCAGGAAGGTAAAGACATCGTAGTTGATGAGCTCAAAAGCATGATCAAAATATA...

CDS

Download CDS FASTA

1428 bp · LXL04_009930|LXL04_009930|OH1004|CDS

ATGGTGGTTCTTCGATCCTGCAAGTTTGCTGATCATACTTTATCATCAAATTCGAATCGCATTTCGAGAATTTTCTTCAAAAACTCATTTTCTTCGACCAACGCACAAACCTCTTCAGTTCAGAATCATGATGCTCTATATAAGCGAATCTCACTGTCCGCAATAATGCAAAAGACTTCAGTTGTTCCGATAATCGAGCAATGGGTCCAGGAAGGTAAAGACATCGTAGTTGATGAGCTCAAAAGCATGATCAAAATATA...

Protein

Download Protein FASTA

475 aa · LXL04_009930|LXL04_009930|OH1004|PROTEIN

MVVLRSCKFADHTLSSNSNRISRIFFKNSFSSTNAQTSSVQNHDALYKRISLSAIMQKTSVVPIIEQWVQEGKDIVVDELKSMIKIYRNHNRYSQALQLSEWMTNRSYLDQSSGNLAIHLDLISRVHSLEQAEKFFDSIPDSKKNFKVYGTLLNCYTFKNSLTKAEATMEKMIQLGFMTTHSYHSMLTLYTKTQNYKKLVKLIDQMEKSCIRYHRQTYYILLTAYASFDIKSMTNLLGYMETSPNLSPDWHVYIIAAKGY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009930`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009930

Location Chr02:136093181-136094789 (+)

Description Similar to At2g20710: Pentatricopeptide repeat-containing protein At2g20710, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g20710`	Pentatricopeptide repeat-containing protein At2g20710, mitochondrial.	No verified direct reference in this release
`At4g21705`	Pentatricopeptide repeat-containing protein At4g21705, mitochondrial.	No verified direct reference in this release
`At1g02150`	Pentatricopeptide repeat-containing protein At1g02150.	No verified direct reference in this release
`At4g02820`	Pentatricopeptide repeat-containing protein At4g02820, mitochondrial.	No verified direct reference in this release
`At1g28020`	Putative pentatricopeptide repeat-containing protein At1g28020.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009930 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000963 mitochondrial RNA processing Biological Process

GO:0008380 RNA splicing Biological Process

GO:1903427 negative regulation of reactive oxygen species biosynthetic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G02150

ath:AT2G20710

ath:AT4G02820

ath:AT4G21705

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.838

Rank 1 · LXL04_009930 · OH-1004

Plastid0.060

Rank 2 · LXL04_009930 · OH-1004

Nucleus0.055

Rank 3 · LXL04_009930 · OH-1004

Cytoplasm0.043

Rank 4 · LXL04_009930 · OH-1004

Cell membrane0.009

Rank 5 · LXL04_009930 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01535.27PPR359-386 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009930	`PF01535.27`	PPR	359	386	1.2e-13	51.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SKU6`	Arabidopsis thaliana	Pentatricopeptide repeat-containing protein At2g20710, mitochondrial	37.559%	Swiss-Prot	moderate database homology
`Q84JR3`	Arabidopsis thaliana	Pentatricopeptide repeat-containing protein At4g21705, mitochondrial	31.250%	Swiss-Prot	moderate database homology
`Q8LPS6`	Arabidopsis thaliana	Pentatricopeptide repeat-containing protein At1g02150	31.553%	Swiss-Prot	moderate database homology
`Q9SY07`	Arabidopsis thaliana	Pentatricopeptide repeat-containing protein At4g02820, mitochondrial	31.368%	Swiss-Prot	moderate database homology
`Q9C7F1`	Arabidopsis thaliana	Putative pentatricopeptide repeat-containing protein At1g28020	33.828%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card