LXL04_009923 | RubberDandelionOmics

Gene overview

LXL04_009923

Reference: OH-1004 Chr: Chr02 Coordinates: 135997306-135999551 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

789 bp · LXL04_009923|LXL04_009923|OH1004|cDNA

ATGATGTTTCTCTTATCTTTTTCCGTAGATAATACAGATTCAGTGTTAATTTTAATATGCACTGATAGGTCGATTAAAGCGGCCCTAGACAAGCTGGATTTATCGCAAAATGGCGGGATttatctgtcaggcatttcaAGAGTCAAGTTTTGGTTTTTGATAAATGGTGGATCCACTGTTAACAGTGGTTCTAGCTACATGAATCCATGGTCAATCTCTACTGTCAACAATCTACTGCAAAAGATGAATTCTCAAATATT...

CDS

Download CDS FASTA

789 bp · LXL04_009923|LXL04_009923|OH1004|CDS

ATGATGTTTCTCTTATCTTTTTCCGTAGATAATACAGATTCAGTGTTAATTTTAATATGCACTGATAGGTCGATTAAAGCGGCCCTAGACAAGCTGGATTTATCGCAAAATGGCGGGATTTATCTGTCAGGCATTTCAAGAGTCAAGTTTTGGTTTTTGATAAATGGTGGATCCACTGTTAACAGTGGTTCTAGCTACATGAATCCATGGTCAATCTCTACTGTCAACAATCTACTGCAAAAGATGAATTCTCAAATATT...

Protein

Download Protein FASTA

262 aa · LXL04_009923|LXL04_009923|OH1004|PROTEIN

MMFLLSFSVDNTDSVLILICTDRSIKAALDKLDLSQNGGIYLSGISRVKFWFLINGGSTVNSGSSYMNPWSISTVNNLLQKMNSQILKYQVRNFGDLLDTVQVVNVIQGKCRYISSLQKSARNKIKGCAGKGAFAQVYKACLNNNADDLVALKIQKPSFPWDIYMYCQLDKRIAENEVDPIKFQNGLSSLCPSSNRWSMLGTNNSIKWNGIGHGEGMRRRFSRVKVATDPSPCSSDAVVDDYYAVLGLARSQARNSMGLG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009923`
TK1151 ID	TkA03G483000
OH-1004 ID	LXL04_009923
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	90.700
Protein coverage (%)	TK1151 74.843 / OH-1004 94.275 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009923

Location Chr02:135997306-135999551 (-)

Description Similar to BUB1: Mitotic checkpoint serine/threonine-protein kinase BUB1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g20635`	Serine/threonine-protein kinase that performs 2 crucial functions during mitosis: it is essential for spindle-assembly checkpoint signaling and for correct chromosome alignment.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009923 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007059 chromosome segregation Biological Process

GO:0007094 mitotic spindle assembly checkpoint signaling Biological Process

GO:0051301 cell division Biological Process

GO:0051754 meiotic sister chromatid cohesion, centromeric Biological Process

GO:0000776 kinetochore Cellular Component

GO:0000940 outer kinetochore Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT2G20635

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.371

Rank 1 · LXL04_009923 · OH-1004

Nucleus0.370

Rank 2 · LXL04_009923 · OH-1004

Mitochondrion0.140

Rank 3 · LXL04_009923 · OH-1004

Cell membrane0.116

Rank 4 · LXL04_009923 · OH-1004

Endoplasmic reticulum0.084

Rank 5 · LXL04_009923 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IVI0`	Arabidopsis thaliana	Mitotic checkpoint serine/threonine-protein kinase BUB1	45.600%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card