Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1644 bp · LXL04_009900|LXL04_009900|OH1004|cDNA
ATGACTCCCGACCCCACGCCGGAGCTGCAAATATCTCCTGCTGATCCGCATGGCGGAAGTCCAGGTAAGGATCAACAGGCGGCAGGGGTAGGCATTCTTCTGCAGATTATGATGCTCGTCCTTTCATTCATTCTGGGACATGTCTTACGGCGTCATAGATTCTATTATCTTCCTGAAGCAAGCGCCTCTCTTTTGATCGGGTTAATTGTTGGTGGACTTGCGAATATCTCGAATACCGAAACTAGTATCAGGTTTTTGAA...
1644 bp · LXL04_009900|LXL04_009900|OH1004|CDS
ATGACTCCCGACCCCACGCCGGAGCTGCAAATATCTCCTGCTGATCCGCATGGCGGAAGTCCAGGTAAGGATCAACAGGCGGCAGGGGTAGGCATTCTTCTGCAGATTATGATGCTCGTCCTTTCATTCATTCTGGGACATGTCTTACGGCGTCATAGATTCTATTATCTTCCTGAAGCAAGCGCCTCTCTTTTGATCGGGTTAATTGTTGGTGGACTTGCGAATATCTCGAATACCGAAACTAGTATCAGGTTTTTGAA...
Protein
Download Protein FASTA547 aa · LXL04_009900|LXL04_009900|OH1004|PROTEIN
MTPDPTPELQISPADPHGGSPGKDQQAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISNTETSIRFLNAFSDGFSLAPKPFFSNFGAIVTFAILGTFIASIVTGLLVYLGGVMYLMYRLPLVECLMFGALISATDPVTVLSIFQELGSDMNLYALVFGESVLNDAMAISLYRTMSLVRSNSSGQNFFMIVVRFLETFVGSMSAGVGVGFTSALISFFIVIIALKLYTNFLLFVINLNCRNL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_009900 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_009900 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:135661592-135666390 (+) | |||||||||
| Description | Similar to NHX6: Sodium/hydrogen exchanger 6 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0001675 acrosome assembly Biological Process GO:0006813 potassium ion transport Biological Process GO:0006814 sodium ion transport Biological Process GO:0035725 sodium ion transmembrane transport Biological Process GO:0051453 regulation of intracellular pH Biological Process GO:0071805 potassium ion transmembrane transport Biological Process GO:0098719 sodium ion import across plasma membrane Biological Process GO:1902600 proton transmembrane transport Biological Process GO:1905526 regulation of Golgi lumen acidification Biological Process GO:0000139 Golgi membrane Cellular Component GO:0001669 acrosomal vesicle Cellular Component GO:0005737 cytoplasm Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G54370 ath:AT1G79610 gga:419356 hsa:23315 mmu:77031 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00999.27Na_H_Exchanger43-453 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_009900 | PF00999.27 | Na_H_Exchanger | 43 | 453 | 3e-52 | 178.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.