LXL04_009791 | RubberDandelionOmics

Gene overview

LXL04_009791

Reference: OH-1004 Chr: Chr02 Coordinates: 133446561-133448220 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1545 bp · LXL04_009791|LXL04_009791|OH1004|cDNA

ATGTGGACTTTTTTGGATCATATAATCATTTACATATTGCCGTTGTTTGTGGGTGCGGCGTTCCTGATCATCAGATGGTACAGTTGTACACCACCGACCACCACCAAGAAACTACCGCCGTCACCACCAACGTTGCCGATAATCGGCAACCTCCACCAATTGGGAGCACTCGTCCACCACTCTTTCTTCTCTCTGGCAAAACGTTACGGCGACTCCCTGATGCTCCTCCACATCGGCTCAGTCCCAAGCCTGGTGGTCTC...

CDS

Download CDS FASTA

1545 bp · LXL04_009791|LXL04_009791|OH1004|CDS

ATGTGGACTTTTTTGGATCATATAATCATTTACATATTGCCGTTGTTTGTGGGTGCGGCGTTCCTGATCATCAGATGGTACAGTTGTACACCACCGACCACCACCAAGAAACTACCGCCGTCACCACCAACGTTGCCGATAATCGGCAACCTCCACCAATTGGGAGCACTCGTCCACCACTCTTTCTTCTCTCTGGCAAAACGTTACGGCGACTCCCTGATGCTCCTCCACATCGGCTCAGTCCCAAGCCTGGTGGTCTC...

Protein

Download Protein FASTA

514 aa · LXL04_009791|LXL04_009791|OH1004|PROTEIN

MWTFLDHIIIYILPLFVGAAFLIIRWYSCTPPTTTKKLPPSPPTLPIIGNLHQLGALVHHSFFSLAKRYGDSLMLLHIGSVPSLVVSSTEAAREIMKTHDLAFASRPTTRMFRAISYNLKEITVAPYGEYWRQAKSILTLQLLSNKKVQSFDAMRETIIRDCLSKITQSFSSNSPADLSDLFSSLTNDITCMATFGKTYNDGEIGRKFKKIMQEFSEVLGSFYFEDSIPQLAVVDRLTGLTAKVDRVAKDFDEFLQNVVD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009791`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009791

Location Chr02:133446561-133448220 (+)

Description Similar to CYP736A117: Cytochrome P450 736A117

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g48280`	Cytochrome P450 71A25.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009791 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016114 terpenoid biosynthetic process Biological Process

GO:0035835 indole alkaloid biosynthetic process Biological Process

GO:0051762 sesquiterpene biosynthetic process Biological Process

GO:0000137 Golgi cis cisterna Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0016020 membrane Cellular Component

GO:0004497 monooxygenase activity Molecular Function

GO:0005506 iron ion binding Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Molecular Function

KEGG gene cross-reference

ag:ADZ48681

ath:AT3G48280

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.923

Rank 1 · LXL04_009791 · OH-1004

Cell membrane0.043

Rank 2 · LXL04_009791 · OH-1004

Cytoplasm0.038

Rank 3 · LXL04_009791 · OH-1004

Plastid0.035

Rank 4 · LXL04_009791 · OH-1004

Golgi apparatus0.024

Rank 5 · LXL04_009791 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067.28p45039-498 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009791	`PF00067.28`	p450	39	498	7.8e-95	319.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9STK8`	Arabidopsis thaliana	Cytochrome P450 71A25	46.122%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card