LXL04_009759 | RubberDandelionOmics

Gene overview

LXL04_009759

Reference: OH-1004 Chr: Chr02 Coordinates: 132807628-132808615 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

549 bp · LXL04_009759|LXL04_009759|OH1004|cDNA

ATGGCGTCAGAAAGGAAGCAGGCGAACCCAATGAGGGAAATTAAGGTTCAGAAACTCGTCCTCAACATCTCAGTCGGAGAAAGTGGCGATCGTCTCACCCGTGCTGCCAAGGTTTTGGAGCAACTGAGCGGCCAATCCCCTGTCTTCTCAAAGGCAAGGTACACTGTGAGGTCATTTGGAATCAGGCGTAATGAGAAAATCGCATGTTACGTGACTGTTAGAGGAGACAAAGCTATGCAACTATTGGAAAGTGGATTGAA...

CDS

Download CDS FASTA

549 bp · LXL04_009759|LXL04_009759|OH1004|CDS

ATGGCGTCAGAAAGGAAGCAGGCGAACCCAATGAGGGAAATTAAGGTTCAGAAACTCGTCCTCAACATCTCAGTCGGAGAAAGTGGCGATCGTCTCACCCGTGCTGCCAAGGTTTTGGAGCAACTGAGCGGCCAATCCCCTGTCTTCTCAAAGGCAAGGTACACTGTGAGGTCATTTGGAATCAGGCGTAATGAGAAAATCGCATGTTACGTGACTGTTAGAGGAGACAAAGCTATGCAACTATTGGAAAGTGGATTGAA...

Protein

Download Protein FASTA

182 aa · LXL04_009759|LXL04_009759|OH1004|PROTEIN

MASERKQANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFFVVLERPGYRVGRRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNKSQQIGG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009759`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009759

Location Chr02:132807628-132808615 (-)

Description Similar to RPL11: 60S ribosomal protein L11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g42740`	Component of the ribosome, a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell.	No verified direct reference in this release
`UniProt: P42794`	Component of the ribosome, a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0207300`	Component of the ribosome, a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell.	No verified direct reference in this release
`UniProt: A2YDY2`	Component of the ribosome, a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009759 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006412 translation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005840 ribosome Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009536 plastid Cellular Component

GO:0015934 large ribosomal subunit Cellular Component

GO:0022625 cytosolic large ribosomal subunit Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

KEGG gene cross-reference

ath:AT2G42740

ath:AT3G58700

ath:AT4G18730

ath:AT5G45775

dosa:Os05g0207300

dosa:Os06g0550000

osa:4341262

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.823

Rank 1 · LXL04_009759 · OH-1004

Nucleus0.289

Rank 2 · LXL04_009759 · OH-1004

Endoplasmic reticulum0.172

Rank 3 · LXL04_009759 · OH-1004

Mitochondrion0.050

Rank 4 · LXL04_009759 · OH-1004

Cell membrane0.033

Rank 5 · LXL04_009759 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00281.25Ribosomal_L59-62 aa

PF00673.27Ribosomal_L5_C66-164 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009759	`PF00281.25`	Ribosomal_L5	9	62	2.9e-21	76.2
LXL04_009759	`PF00673.27`	Ribosomal_L5_C	66	164	2.3e-18	66.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P42795`	Arabidopsis thaliana	Large ribosomal subunit protein uL5z	93.956%	Swiss-Prot	strong database homology
`P42794`	Arabidopsis thaliana	Large ribosomal subunit protein uL5y/uL5x/uL5w	93.407%	Swiss-Prot	strong database homology
`Q0DK10`	Oryza sativa subsp. japonica	Large ribosomal subunit protein uL5	93.820%	Swiss-Prot	strong database homology
`A2YDY2`	Oryza sativa subsp. indica	Large ribosomal subunit protein uL5	93.820%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card