LXL04_009697 | RubberDandelionOmics

Gene overview

LXL04_009697

Reference: OH-1004 Chr: Chr02 Coordinates: 131420350-131422291 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1482 bp · LXL04_009697|LXL04_009697|OH1004|cDNA

ATGGGTGAGATGGTCGATGAAATCAAGCTTGGAGAAGGTGCTTCAGAGAACAAGATTCATATAATAAACGATGATGGTGAAATTGTAAGCAAACGTATACTCGAGAACTACGTAACATCTCCTCAACAAGATTCCGAGGATAATCGGAATGGAATCAACCACGAATCAGACGAATGGCTTCCCATTACGCGATCAAGAAACGGGAATTCCTGGACAGCCACTTTCCATTTGATTTGTTCCGGAATCGGAATCCAAACACT...

CDS

Download CDS FASTA

1482 bp · LXL04_009697|LXL04_009697|OH1004|CDS

ATGGGTGAGATGGTCGATGAAATCAAGCTTGGAGAAGGTGCTTCAGAGAACAAGATTCATATAATAAACGATGATGGTGAAATTGTAAGCAAACGTATACTCGAGAACTACGTAACATCTCCTCAACAAGATTCCGAGGATAATCGGAATGGAATCAACCACGAATCAGACGAATGGCTTCCCATTACGCGATCAAGAAACGGGAATTCCTGGACAGCCACTTTCCATTTGATTTGTTCCGGAATCGGAATCCAAACACT...

Protein

Download Protein FASTA

493 aa · LXL04_009697|LXL04_009697|OH1004|PROTEIN

MGEMVDEIKLGEGASENKIHIINDDGEIVSKRILENYVTSPQQDSEDNRNGINHESDEWLPITRSRNGNSWTATFHLICSGIGIQTLSLPLAFVYLGWFWGILCLCVAFIWQLYTIGLLVSLHESVPGTRYSRYLQLSMAAFGEKLGKIIAIFPVLYLAGGTCLMFIITGGGTMKLFYQLLCDDCSSKHPLTTTEWFLVFTCLAIFVSLFCPNLNSVSLVSFFGAIMAVGYCTTLWVMVVAKGKVDGTIYDPSKVVESNA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009697`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009697

Location Chr02:131420350-131422291 (+)

Description Similar to AATL1: Lysine histidine transporter-like 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g47670`	Amino acid transporter.	No verified direct reference in this release
`At4g35180`	Amino acid transporter.	No verified direct reference in this release
`At5g40780`	Amino acid-proton symporter.	Arabidopsis LHT1 is a high-affinity transporter for cellular amino acid uptake in both root epidermis and leaf mesophyll.2006 · DOI: 10.1105/tpc.106.041012 Comprehensive screening of Arabidopsis mutants suggests the lysine histidine transporter 1 to be involved in plant uptake of amino acids.2007 · DOI: 10.1104/pp.106.092205 Root uptake of cationic amino acids by Arabidopsis depends on functional expression of amino acid permease 5.2008 · DOI: 10.1111/j.1469-8137.2008.02589.x LHT1, a lysine- and histidine-specific amino acid transporter in arabidopsis.1997 · DOI: 10.1104/pp.115.3.1127
`At1g48640`	Amino acid transporter.	No verified direct reference in this release
`At1g24400`	Amino acid-proton symporter.	Selective expression of a novel high-affinity transport system for acidic and neutral amino acids in the tapetum cells of Arabidopsis flowers.2004 · DOI: 10.1111/j.1365-313x.2004.02186.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009697 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0003333 amino acid transmembrane transport Biological Process

GO:0006952 defense response Biological Process

GO:0043090 amino acid import Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

GO:0015171 amino acid transmembrane transporter activity Molecular Function

GO:0015172 acidic amino acid transmembrane transporter activity Molecular Function

GO:0015293 symporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G24400

ath:AT1G47670

ath:AT1G48640

ath:AT4G35180

ath:AT5G40780

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.618

Rank 1 · LXL04_009697 · OH-1004

Lysosome / Vacuole0.180

Rank 2 · LXL04_009697 · OH-1004

Endoplasmic reticulum0.121

Rank 3 · LXL04_009697 · OH-1004

Cytoplasm0.085

Rank 4 · LXL04_009697 · OH-1004

Golgi apparatus0.057

Rank 5 · LXL04_009697 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01490.25Aa_trans67-475 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009697	`PF01490.25`	Aa_trans	67	475	2.4e-56	191.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SX98`	Arabidopsis thaliana	Lysine histidine transporter-like 8	46.737%	Swiss-Prot	moderate database homology
`Q84WE9`	Arabidopsis thaliana	Lysine histidine transporter-like 7	45.534%	Swiss-Prot	moderate database homology
`Q9FKS8`	Arabidopsis thaliana	Lysine histidine transporter 1	34.505%	Swiss-Prot	moderate database homology
`Q9C733`	Arabidopsis thaliana	Lysine histidine transporter-like 1	35.022%	Swiss-Prot	moderate database homology
`Q9LRB5`	Arabidopsis thaliana	Lysine histidine transporter 2	34.943%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card