LXL04_009691 | RubberDandelionOmics

Gene overview

LXL04_009691

Reference: OH-1004 Chr: Chr02 Coordinates: 131311220-131313733 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1632 bp · LXL04_009691|LXL04_009691|OH1004|cDNA

ATGTTTCCTTCTACTTCTAGGATGACGAAGAAAAGAGACCGAGCGAGCATTGATACGGCAGTCTTCGATATCTGCCGCCGTGAGGTCGGCCATCTTTCAACCCGAAAATTCGTCAACCGGCTCGCCGCTTCAGAGGATCTAGTCCTGAGACTTGCTCTTTCGAGGAAGCTAGAAAAACACAGAGGATGTGTCAACACAGTGAGCTTCAATGATAATGGAGATATACTTGTATCTGGATCAGATGACAGAAGAGTTATACT...

CDS

Download CDS FASTA

1632 bp · LXL04_009691|LXL04_009691|OH1004|CDS

ATGTTTCCTTCTACTTCTAGGATGACGAAGAAAAGAGACCGAGCGAGCATTGATACGGCAGTCTTCGATATCTGCCGCCGTGAGGTCGGCCATCTTTCAACCCGAAAATTCGTCAACCGGCTCGCCGCTTCAGAGGATCTAGTCCTGAGACTTGCTCTTTCGAGGAAGCTAGAAAAACACAGAGGATGTGTCAACACAGTGAGCTTCAATGATAATGGAGATATACTTGTATCTGGATCAGATGACAGAAGAGTTATACT...

Protein

Download Protein FASTA

543 aa · LXL04_009691|LXL04_009691|OH1004|PROTEIN

MFPSTSRMTKKRDRASIDTAVFDICRREVGHLSTRKFVNRLAASEDLVLRLALSRKLEKHRGCVNTVSFNDNGDILVSGSDDRRVILWDWETGNVKLAFHSGHNNNIFQAKIMPGTDDRSIVTCAADGQVRHAMIPENGEIETKLLGKHHGRAHKLANEPGSPHIFYTCGEDGLVQHFDLRTGIATELFSCQPISDRSFTGIINLNSIAIDPRNPNLFAIAGSDEFTRVYDIRQYKWDGSTPFGKPTNYFCPHHLINDEN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009691`
TK1151 ID	TkA03G462790
OH-1004 ID	LXL04_009691
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.100
Protein coverage (%)	TK1151 89.729 / OH-1004 86.372 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_009691`
Location	Chr02:131311220-131313733 (+)
Description	Similar to DCAF8: DDB1- and CUL4-associated factor 8
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_009691` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0007283 spermatogenesis Biological Process GO:0007338 single fertilization Biological Process GO:0016567 protein ubiquitination Biological Process GO:0040029 epigenetic regulation of gene expression Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005829 cytosol Cellular Component GO:0080008 Cul4-RING E3 ubiquitin ligase complex Cellular Component
KEGG gene cross-reference	hsa:347442 hsa:50717 mmu:98193 rno:364050 xla:431952 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.684

Rank 1 · LXL04_009691 · OH-1004

Cytoplasm0.304

Rank 2 · LXL04_009691 · OH-1004

Cell membrane0.041

Rank 3 · LXL04_009691 · OH-1004

Mitochondrion0.033

Rank 4 · LXL04_009691 · OH-1004

Lysosome / Vacuole0.028

Rank 5 · LXL04_009691 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24105.2Beta-prop_CAF1B_HIR144-101 aa

PF25047.1Beta-prop_TEP1_2nd50-180 aa

PF25175.2Beta-prop_WDR552-187 aa

PF25391.2WD40_Gbeta52-193 aa

PF23381.2Beta-prop_IFT122_1st53-132 aa

PF00400.39WD4055-89 aa

PF25173.2Beta-prop_WDR3_1st55-143 aa

PF24796.2WDR5555-131 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009691	`PF24105.2`	Beta-prop_CAF1B_HIR1	44	101	1.1e-10	41.8
LXL04_009691	`PF25047.1`	Beta-prop_TEP1_2nd	50	180	1.2e-09	38.4
LXL04_009691	`PF25175.2`	Beta-prop_WDR5	52	187	8.8e-31	108.0
LXL04_009691	`PF25391.2`	WD40_Gbeta	52	193	2.4e-08	34.1
LXL04_009691	`PF23381.2`	Beta-prop_IFT122_1st	53	132	1.5e-20	74.4
LXL04_009691	`PF00400.39`	WD40	55	89	1.8e-26	92.1
LXL04_009691	`PF25173.2`	Beta-prop_WDR3_1st	55	143	1.6e-19	71.1
LXL04_009691	`PF24796.2`	WDR55	55	131	7.3e-11	42.4
LXL04_009691	`PF25171.2`	Beta-prop_WDR36-Utp21_1st	56	131	2.6e-07	31.1
LXL04_009691	`PF24807.2`	WD40_CDC20-Fz	57	183	2.3e-12	47.6
LXL04_009691	`PF24805.2`	EIF3I	57	131	1.3e-06	28.5
LXL04_009691	`PF23409.2`	Beta-prop_EML	58	124	2.1e-09	38.0
LXL04_009691	`PF25174.2`	Beta-prop_THOC3	60	131	5.1e-23	82.2
LXL04_009691	`PF24814.2`	WD40_Prp19	64	278	3.2e-18	66.5
LXL04_009691	`PF25175.2`	Beta-prop_WDR5	334	415	8.8e-31	108.0
LXL04_009691	`PF23381.2`	Beta-prop_IFT122_1st	354	418	1.5e-20	74.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card