LXL04_009672 | RubberDandelionOmics

Gene overview

LXL04_009672

Reference: OH-1004 Chr: Chr02 Coordinates: 130998867-130999847 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

981 bp · LXL04_009672|LXL04_009672|OH1004|cDNA

ATGCAACACCAACCCTTGCAAACGACACAACCACGACGCCTATTTGACGAAGAATCTTCCAATGAAGACGAAGAGGAATCAAACTTCAATTACAACCTCGATGACGAAGATGACGAGCCCGAGCCCGAACCCGAACCCGAACCCCAAACGAGAAAAAGAGGAAAAgcaaaaggaaaagaaaaagaaccGGTGCAACAATCACAAAGCAGACTTATTTGGAAAGACAAAGAAGTGAAGGCATTGGCACAAGCATGGCTTGA...

CDS

Download CDS FASTA

981 bp · LXL04_009672|LXL04_009672|OH1004|CDS

ATGCAACACCAACCCTTGCAAACGACACAACCACGACGCCTATTTGACGAAGAATCTTCCAATGAAGACGAAGAGGAATCAAACTTCAATTACAACCTCGATGACGAAGATGACGAGCCCGAGCCCGAACCCGAACCCGAACCCCAAACGAGAAAAAGAGGAAAAGCAAAAGGAAAAGAAAAAGAACCGGTGCAACAATCACAAAGCAGACTTATTTGGAAAGACAAAGAAGTGAAGGCATTGGCACAAGCATGGCTTGA...

Protein

Download Protein FASTA

326 aa · LXL04_009672|LXL04_009672|OH1004|PROTEIN

MQHQPLQTTQPRRLFDEESSNEDEEESNFNYNLDDEDDEPEPEPEPEPQTRKRGKAKGKEKEPVQQSQSRLIWKDKEVKALAQAWLEVSEADERGNDQDLAAFRQRVWEAFCTRMRKVYRNPTQIYAKWRPTNKSVMKFNGIYVNFCRQPPSGANQMDIIGLAEQQYADVTGTVFKSKVFWDVVKNHPKWLALKSPDDFTCGRGSKRSKTSSSTYTNTESSDGRTGIDLNVEEEPSEPPTVHVGRDAARAKRKQKGVADS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009672`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009672

Location Chr02:130998867-130999847 (-)

Description Similar to GSTT3: Glutathione S-transferase T3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g41220`	May be involved in the conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles and have a detoxification role against certain herbicides.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009672 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009407 toxin catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009536 plastid Cellular Component

GO:0004364 glutathione transferase activity Molecular Function

KEGG gene cross-reference

ath:AT5G41220

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.962

Rank 1 · LXL04_009672 · OH-1004

Cytoplasm0.142

Rank 2 · LXL04_009672 · OH-1004

Mitochondrion0.017

Rank 3 · LXL04_009672 · OH-1004

Cell membrane0.014

Rank 4 · LXL04_009672 · OH-1004

Extracellular0.011

Rank 5 · LXL04_009672 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FHE1`	Arabidopsis thaliana	Glutathione S-transferase T3	26.316%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card